KEGG   Plutella xylostella (diamondback moth): 105382330Help
Entry
105382330         CDS       T03915                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial-like
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00190  Oxidative phosphorylation
pxy01100  Metabolic pathways
Module
pxy_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105382330
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     105382330
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     105382330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 105382330
NCBI-ProteinID: XP_011550494
Position
Un
AA seq 263 aa AA seqDB search
MSFYLKRALGAGCKVGRVVLQNTRTPVVQRVATKADQAGAAETRPTVAKYDPLQKSQLVD
FGKYVAECMPKFVQKVQITSGNELEVLVPPEGALPVLTFLKDHHAAQFASLVDIAGMDVP
ARAHRFEIIYNLLSLRYNARIRVKTYTDELSPLDSANEVFKAANWYEREIWDMYGVFFAN
HPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEQKRVVVEPLELAQEFRRFELEAPWE
QFPNFRGNPVEDVTPGAGDKPKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttacttaaaaagagccctaggggccggttgcaaagtgggccgagtagttttg
caaaacacgcggaccccagtggtgcagcgcgtggcgacgaaggcggaccaggcgggcgcg
gcggagacccggcccaccgtcgccaagtacgacccgctgcagaagtcgcagctcgtggac
ttcggcaagtacgtggcggagtgcatgcccaagttcgtgcagaaggtacagatcacgtcg
ggcaacgagctggaggtgctggtgccgccggagggcgcgctgcccgtgctcacgttcctc
aaggaccaccacgcggcgcagttcgccagcctcgtggacatcgcgggcatggacgtgccg
gcgcgcgcgcaccgcttcgagatcatctacaacctgctgtcgctgcgctacaacgcgcgc
atccgcgtcaagacctacacggacgagctgagcccgctcgactccgccaacgaggtgttc
aaggccgccaactggtacgagcgcgagatctgggacatgtacggagtgttcttcgccaac
caccctgacctcaggaggatcttgacagactacggctttgaaggacatccattcagaaag
gacttccccctcagtgggtatgtggaggtgaggtatgatgatgagcagaagcgcgtggtg
gtggagccgctggagctggcgcaggagttccgcaggttcgagctggaggctccgtgggag
cagttccccaacttccgaggcaacccggtggaggatgtcaccccaggtgcaggagacaaa
cccaaggaataa

DBGET integrated database retrieval system