KEGG   Plutella xylostella (diamondback moth): 105386575Help
Entry
105386575         CDS       T03915                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00061  Fatty acid biosynthesis
pxy01100  Metabolic pathways
pxy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105386575
Enzymes [BR:pxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     105386575
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     105386575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 DUF5073 GDP_Man_Dehyd ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 105386575
NCBI-ProteinID: XP_011555471
UniProt: A0A1Q3G5H9
Position
Un
AA seq 193 aa AA seqDB search
MVAGIVTGRLAFVTGAGSGIGRAACQVLSREGATVIAADRNYDQAVETIKKHTSLAHGSN
GIGDHSALELDVSDSKAVQNALEQTLKLYKKPPTIVINSAGITRDNWMLKLSEADYDSVL
DVNLKGTFLVMQAFARAMTEAAVTSGSIVNISSIVGKYGNIGELLLQLAIIARPTLGSQR
QTLNWMAHSFHSQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaggtattgttacagggcgccttgcgttcgttacaggtgccgggtcgggcatc
ggccgagcggcgtgccaggtgttgtcccgtgagggcgccacagtgatagcggctgacaga
aactatgaccaggccgtggaaactataaagaagcacacctccctggctcatgggtcaaat
ggtattggtgatcacagtgcactagaattggatgtttctgactcgaaagcagtgcagaat
gctctagaacaaacattgaagttgtataagaagcctcccaccatcgtcatcaactcggcc
ggcatcacgagggacaactggatgctcaaactgtccgaggctgactatgacagcgtactt
gatgtcaatttgaagggcacattcctggtgatgcaagcgtttgcaagagctatgacagaa
gctgccgtcacctctgggtccattgtcaacatttccagtattgttgggaagtatggcaat
ataggtgagcttttacttcagttagcaatcatagctaggcctaccctgggcagtcagcgg
cagacgctaaactggatggctcattcctttcattcacagtga

DBGET integrated database retrieval system