KEGG   Plutella xylostella (diamondback moth): 105388458Help
Entry
105388458         CDS       T03915                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00511  Other glycan degradation
pxy00600  Sphingolipid metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105388458
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105388458
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     105388458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H DUF5127
Motif
Other DBs
NCBI-GeneID: 105388458
NCBI-ProteinID: XP_011557667
Position
Un
AA seq 936 aa AA seqDB search
MEVVDDEGMDIPPKYGLKFRLNHEFPLQSKQIIKPTAKQLIEMLPLTTRYLFYYMDRKMH
KKKPIMDYIHLVSAQRKYGCPIGGIGGGTIGRGFKGEFCRFQLIPGIYEYITVPECQFIV
NIKNGDNETIFQSVLATYDKPKKSPASWEWNLNGEDCEYTALYPRAWTTYDLSKYGIKLT
CRQISPVIPHNYKDSSLPCAVFVWTAKNVSQEQRHVSVTFTWTEILPNKKKPQKIDIERY
SEENTCGVQLEQKIADTPCTFTIAKTKDENETIHEGYCTFNAAKNSKYVWDCIKTKGKLE
PDTTDEKHKNQSDESKEEKNHAKKSYIPDSIGLSSCMSLDPGGTDTAEFSLVWDMPVVKY
KKDGVVNKRFYTRYFGSDGIAGASIAAYALKKYKKWEKQLSEWQDPILNNSNIPDWLKSA
LMNELYFVADGGTIWFDVSDEFPENDPRHHFGLFGYLEGHEYRMYNTYDVHFYASFALAQ
LWPNLQVVIQYMFRDTIAMESEKTRPSIYNGKTSKYKVKNSIPHDLGDPEGEPFKNINAY
NIHDVSEWRDLNIKFILQVTRDYRLLKGHSAPFDRDRYRSLEFIDDDRDCNEDLYVRATG
QGDHKPRSASVTQQDPSTPPTQHASKPSPVGNILEMLYRNEEKTIEADSEESDDECDAAT
WDAKRYVSDMYEPVVALLRQTLTWDQDKDGLIENSGWPDQTYDAWVMSGPSAYCGGLWVA
AISSVCALARVLGREADEAEFSALLDRARASFDEKLWTGTHYRFDTKTSERVVMSDQLAG
QWFLRASGLSEAFPAANVRKSLRTIYDNNVLKFGHGRMGAVNGFVLGDKSRAGRVDYTAL
QSGEMWTGVTYGLAALMIYEGMHEEAFATAGGMYNTLTQMGLAFETPEALYENGNHRSIS
YMRPLAVWAMYQAVITRPPAPSSGVVANGQTAKPVL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagttgacgatgaaggtatggatattccaccgaaatatggtcttaagtttcgt
ctgaaccatgaatttcctcttcaaagcaagcaaataataaaaccaacagcaaagcaactt
atagagatgttaccgcttacaaccagataccttttttactacatggatagaaaaatgcac
aaaaaaaaacctattatggattacatacatctcgtctctgctcagagaaagtatggttgt
cctatcggaggtatagggggcggcactataggcagaggtttcaaaggagagttctgcaga
ttccaactaatacccggcatctacgagtacatcaccgtccctgagtgccaattcattgtg
aacattaagaacggagacaatgagaccatattccagtctgtactcgccacttatgacaaa
ccaaagaaatctccagccagttgggaatggaacctcaacggtgaagactgtgaatacaca
gccctataccctcgagcatggaccacatatgacctgtccaagtacggcatcaaactaaca
tgcaggcaaatatcaccagtgattcctcataactacaaggacagtagcctgccctgtgca
gtattcgtgtggacggccaagaacgtgagccaggagcagcggcatgtgagcgtgaccttc
acgtggaccgagatactgcccaataagaagaagccgcaaaaaatcgacatagagcggtat
tccgaagaaaacacgtgcggagttcagttagaacagaaaatagcagataccccgtgcact
ttcacaatagctaaaacaaaagacgagaacgagacaatacatgaaggctattgcacattc
aacgcggcgaaaaactccaaatatgtgtgggattgtataaagaccaaaggaaagttagaa
ccagacacgacggatgagaagcataaaaaccaaagcgatgaaagtaaggaggagaaaaat
catgctaagaaaagttatattcctgattcgataggtctatcaagctgcatgtctctagac
cccgggggaactgacacggcagagttcagtttggtctgggacatgcctgtcgttaaatat
aagaaggatggtgtagttaataaaagattttatactagatattttggtagtgacggcata
gctggagctagcatagcagcgtatgctttaaaaaagtacaaaaaatgggagaaacagctt
tctgaatggcaggatcccattttaaataatagcaatataccggattggttaaaaagtgcc
ttaatgaacgagctttacttcgtggccgatggcgggaccatttggtttgatgtttccgat
gagttccctgaaaatgatccgaggcaccacttcggattgttcgggtacctagaaggacac
gaatatagaatgtacaacacgtacgatgtccatttttatgcgtcatttgcgttggcgcaa
ctctggcctaatctacaggttgtaatacaatacatgttccgagacactatagcgatggaa
tcggagaagactagaccttccatctataacggaaaaacttccaaatacaaagtgaagaat
tcaatacctcacgatttgggcgatcctgaaggagagccgttcaagaacataaacgcgtac
aacatccacgacgtgagcgagtggcgggatctcaacatcaagttcatactgcaggtgacc
cgtgactacagactgctgaagggacatagcgcgccttttgatagggacaggtaccgctcg
ttggaattcatcgacgacgaccgcgattgcaacgaggacctttacgttagagcgaccggc
caaggagaccacaagcctaggagcgcttccgtcacgcaacaagaccccagcacgcccccc
acgcaacacgcctccaagccttccccagtaggaaatatcctagaaatgttgtacaggaat
gaggagaaaacaatcgaagccgactctgaagaaagcgatgatgagtgtgatgcggccact
tgggatgcgaagagatatgtctcggatatgtacgagccagtggttgcgttgttaagacag
acgttgacttgggatcaggataaagatggactgattgagaacagtgggtggccggaccag
acgtatgatgcgtgggtcatgtcggggccgagcgcatactgcggcggtctctgggtagct
gccatcagcagcgtgtgcgccctagcccgggtcctcggccgggaagctgacgaggcagaa
ttcagtgcgctactggaccgggcccgagcctcgtttgatgagaagttgtggaccgggact
cactaccggttcgatacgaagacgagtgaaagggtggtgatgtcggatcagctggctggg
cagtggttcctccgagcatcagggctctccgaagcgttccccgcagccaacgtgcgcaaa
tccctacgaacaatatacgacaacaacgtgttgaaattcggccacggtcgtatgggggcc
gtgaacgggttcgtgttgggagacaagagtcgtgcgggcagagtcgactacacggctctg
cagagcggggagatgtggactggggttacttatggattggccgctttgatgatttatgaa
ggtatgcacgaagaggcgttcgccacggcgggaggtatgtacaacacgttgactcagatg
ggactcgcattcgagactccagaggcactgtacgagaacggcaaccaccggtcgataagc
tacatgcgccctctagcggtgtgggccatgtaccaggccgtcatcacgagaccaccagcg
ccatctagtggcgtcgtggcaaacggacaaacagccaaacctgttttatag

DBGET integrated database retrieval system