KEGG   Plutella xylostella (diamondback moth): 105389084Help
Entry
105389084         CDS       T03915                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00510  N-Glycan biosynthesis
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    105389084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pxy01003]
    105389084
Enzymes [BR:pxy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     105389084
Glycosyltransferases [BR:pxy01003]
 Glycan extension
  N-Glycan
   105389084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 105389084
NCBI-ProteinID: XP_011558450
Position
Un
AA seq 338 aa AA seqDB search
MLPKRPGVCDYVLIAVLLTRPNDTVIVILVRSNQTDLTRLISDFQLVADIDRTLLIFSHF
YVSQYANWEIEAIEYARVLQIFFPFTSQVCPDFFPGPNDLYCEYKADCGVVLRGVRDEGC
AQRKLFWWWTVNFVFEVADIGLFHNTTVLFMEEDDIVTPDFLYTLMLLKDTAKRECPYCD
FLSINGNDPSIYKRQDISPNTAIESAFQATDFSSGLAFNKTIYYKLKIMGDSYCFFNDCG
WQRSLQHMTVSALPMLRFHILYVELPRLLKAGALAAARLRPEQLDRHMFPPALHVRRDPA
PAPGDVTARGNFADVRDRYLCMLSMGMRVFYTNNNTSL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgaaacggccaggcgtttgtgactacgtgctgatagcggtgttgttgacgcga
cccaacgacaccgtcatcgtcattctcgtccggagcaaccagaccgacctcactcgactc
atcagcgacttccaacttgtggccgacatcgatcgaaccttgctaatattctcacacttc
tacgtcagtcagtacgcaaattgggaaatcgaggctatagagtacgctagagttctgcag
atcttctttccgttcacgagccaagtttgtccagatttcttccctgggcccaatgatctg
tactgcgagtacaaggcggactgcggggtggtgctgcggggggtgcgggacgagggctgc
gcgcagaggaagctgttctggtggtggaccgtcaacttcgtgttcgaggtggccgacatc
ggcttgtttcacaacaccaccgtgctcttcatggaagaggatgacatcgtgactccagac
ttcctgtacactctgatgctcctaaaagatacagctaaaagagagtgtccatattgcgac
ttcctgagtatcaacggtaatgatccatccatttacaaacgccaagatatcagcccgaac
actgccatcgagtctgctttccaagcgacagatttttcttcaggtttggcctttaacaag
acgatctattacaagcttaaaatcatgggtgactcgtactgcttcttcaacgactgcggg
tggcagaggtcgctccagcacatgacggtgtcggcgctgccgatgctgaggttccacatc
ctgtacgtggagctgccgcggctgctgaaggcgggggcgctggcggcggcgcggctgcgg
ccggagcagctggaccggcacatgttcccgcccgccctgcatgtgcgccgcgaccccgcg
cccgcccccggtgacgtcactgctcgagggaacttcgccgacgtgcgggaccgctacctc
tgcatgctctctatggggatgagggttttctatacaaataacaacacttcgctttaa

DBGET integrated database retrieval system