KEGG   Plutella xylostella (diamondback moth): 105389546Help
Entry
105389546         CDS       T03915                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase pitchoune
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxy03041]
    105389546
   03009 Ribosome biogenesis [BR:pxy03009]
    105389546
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     105389546
Spliceosome [BR:pxy03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    105389546
Ribosome biogenesis [BR:pxy03009]
 Eukaryotic type
  90S particles
   Helicases
    105389546
  Pre-60S particles
    105389546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII Helicase_C_2 FSH1 BAP AAA_22 OrgA_MxiK
Motif
Other DBs
NCBI-GeneID: 105389546
NCBI-ProteinID: XP_011558979
Position
Un
AA seq 482 aa AA seqDB search
METNNENAKFSSLKDVVSKNTLKALREWGFEHMTEVQAEVIPKALEGADVVATAKTGSGK
TLAFLIPIVEAVCKHLHNEVQGTLCIIISPTRELAMQTFSVLQDLAAYHENITSALVIGG
DSRQKQANILSRGAHIVVATPGRLFDHMQTKYFKYKQVSCLVLDEADKILQYGFEEDVNQ
IINRLPKNRQTMLFSATQSEKTQALTMTAMKDSVDFINTNQDNTEATVEGLKQGYVICKT
EDRLWWLFKVLKKMRKQKVMVFFSSCKSVEFHHEFFSKHCNAPVLCIHGKMNQVDRTHTM
TQFYEAQTGALFCTDVAARGLDIPAVDWIVQFDPPGDTSEYIHRVGRTARGLGAVGNAVL
LLRPEEKEFLEHLKEAKVFLELYKMWDDFDNLQPMLQEAVEKDAEFHKLALEAYEGFIKA
FEVRRLKTVFNIMTLDLAALAKSFGLKDKPEVDIRVGFKKKHRPRKRAVAMLEESSSKSI
KL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaataatgaaaacgcaaagttttccagcctaaaagatgtagtttccaaaaat
actttaaaagctttgagagaatggggatttgaacacatgactgaagtgcaggcggaggtt
ataccgaaggctttagaaggtgcagatgttgtggccacagccaagactggatctgggaaa
accttagccttcttgatcccaatagtagaagctgtgtgtaaacacctacacaatgaggta
caaggtactctctgtataatcatatcaccgaccagagagctagctatgcaaacattttca
gtgcttcaagatttggccgcatatcatgagaacatcacctctgctttagtcataggagga
gatagccgacagaaacaggcaaatatcttgtcaagaggtgcacacattgtagtggctact
ccagggcgactgtttgaccacatgcagaccaaatacttcaagtataaacaagtcagctgt
ttggtactggacgaggctgataaaatacttcagtatggatttgaagaggatgttaatcaa
attattaataggctaccaaaaaacagacaaacaatgttattcagtgctacccaatcggag
aaaacccaggcattgaccatgactgctatgaaggattctgtggacttcatcaatacaaat
caagacaatactgaggccactgttgagggtctgaagcagggctacgtcatatgcaaaaca
gaagaccgtctctggtggctatttaaggtgttgaaaaagatgagaaagcagaaagtcatg
gtattcttctcgagctgcaagtctgtggaatttcaccatgagttcttcagcaaacactgc
aatgcacctgtactttgtatacacggtaagatgaaccaagtggaccgtacgcacacgatg
acacagttctacgaggcacagacgggcgctctgttctgtacggacgtggcggcgcgcggg
ctcgacataccggccgtggactggatcgtgcagtttgacccgccgggcgataccagtgaa
tacatacacagggtgggcagaactgcgcgtgggctaggtgctgttggaaacgcagtctta
ttacttaggccagaagagaaagaattccttgaacacctaaaagaggccaaagttttcttg
gagttgtacaaaatgtgggatgacttcgataaccttcagcctatgttacaagaagcggtg
gaaaaggatgcagagttccacaaactagcgttagaagcttacgagggctttataaaggcg
tttgaggttcgccgcttgaagacagtattcaacataatgacgctggatctagcggccttg
gcgaagtcgtttggactgaaagacaaacctgaagttgatattcgtgttgggttcaagaag
aaacaccggcctcggaaaagggctgtggctatgctggaagaaagtagctcaaagagtatc
aaattataa

DBGET integrated database retrieval system