KEGG   Plutella xylostella (diamondback moth): 105390410Help
Entry
105390410         CDS       T03915                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00260  Glycine, serine and threonine metabolism
pxy01100  Metabolic pathways
pxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105390410
Enzymes [BR:pxy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     105390410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 105390410
NCBI-ProteinID: XP_011560012
Position
Un
AA seq 372 aa AA seqDB search
MTHIVDLRSDTVTKPTDAMRHAMVNSAVGDDVYGEDPTVNALERKIATMLDKQAALFVPS
GTMANLIAVMVHCSQRGSEALVGNMSHIFKYEQGGAAHLGGVLLTTLENKPDGTFDLDEF
EKRIRGSDIHEPVTAMVAVENTHNYCGGKVLPQSWLDDLYARAAKHSIPVHMDGARLFNA
CAAQRSEPATVVRGAASVSICFSKGLSAPVGSVLVGDCHFIQKARRLRKMLGGGMRQAGV
LAAAALVALDEVVPNLEHDHRRAQVLATTIKSLCLKNFTVDLQNTQTNILLVRIPESSPI
TADKVVQRLAQVCLSETQGDCKTADDEGVIVKAIYFNSKTIRFTLHCGIEDEDLWLAIMK
ITFVFKEFEASV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatattgtggatttgagatcagatacagtgacgaagccaacagatgccatgaga
catgccatggtaaattcggctgtaggagacgatgtgtatggtgaggatcccacagtcaat
gccctggagaggaagatcgccaccatgctggataagcaagcagccctgtttgttccctcg
ggaaccatggctaatcttatagccgtgatggtgcactgcagccaacggggctctgaagcg
ctggtgggaaatatgtcacacattttcaagtatgagcaaggaggagcagctcacttaggt
ggagtcttactgacaactcttgagaacaaacctgatggaacttttgacttggacgagttt
gagaagcgcatccgagggtctgatattcatgagccagttacagcaatggtggctgtggag
aatacccacaactattgtgggggcaaggtgttaccgcaatcctggctagacgacctctac
gcccgggctgccaagcactccatcccagtgcacatggacggggctcgcctgttcaacgcg
tgcgcggcgcagcgctcggagccggcgactgtggtgcgcggcgccgccagcgtgtccatc
tgctttagcaagggactgtctgccccggtggggtctgtgcttgtgggcgactgccatttt
attcagaaagcgcgtcgcctacgcaagatgctgggcggcggcatgcggcaggcgggcgtg
ctggccgcggccgccctcgtggcgctggatgaagtggtgccgaatctagagcatgaccat
cgccgcgcgcaggtgttggctacaacaatcaaaagcctctgcctcaaaaacttcacggtc
gaccttcaaaatactcaaactaacatcttgctcgtgcggataccggagtcttctcccata
actgctgacaaagtggtgcagaggctcgcacaagtttgcctctcagagacacagggcgac
tgcaaaacggctgatgatgaaggtgtcatagtaaaagcgatttacttcaattctaagacc
ataaggtttacattgcattgcgggatcgaggacgaagatctgtggctcgctattatgaag
atcacgttcgtttttaaggagttcgaagctagtgtttag

DBGET integrated database retrieval system