KEGG   Plutella xylostella (diamondback moth): 105390697Help
Entry
105390697         CDS       T03915                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00072  Synthesis and degradation of ketone bodies
pxy00280  Valine, leucine and isoleucine degradation
pxy00650  Butanoate metabolism
pxy00900  Terpenoid backbone biosynthesis
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105390697
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    105390697
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105390697
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    105390697
Enzymes [BR:pxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     105390697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 105390697
NCBI-ProteinID: XP_011560338
Position
Un
AA seq 456 aa AA seqDB search
MGGKVENVGILAMETYIPSQYVDQTDLEEFDGVAAGKYTVGLGQSKMGFCSDREDINSLA
MTVLHKLIEMNNIDLHDIGRLEVGTETIIDKSKSVKTFLMTLFAEAGATDIEGIDTTNAC
YGGTAALFNAINWVESSSWDGRKAIVVAGDIAVYGKGPARPTGGAGAVAMLVGPDAPLVF
DRGVRASYMTHAYDFYKPDLASEFPFVDGKLSIKCYLSALDNCYNLFSKKMRRDQPDFKG
LLSLDGMLFHSPYCKLVQKSLARMCFNDFLNTPPEDREKQFPGLSEFSNHKLEETYFDRD
VEKAFMTYSQNLFEEKTKPSLNLARNVGNMYTASLYGSLASYLISKSPEELVGKKFALFS
YGSGLSSTMYSIQICNDVSAGSKLQRLISSLHDSISLIDKRECVKPQTFSDLMDVRTKNY
HTAPYEPSGSIAALFPGTYYLEKIDDQRRRTYGRKE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaaagtagaaaacgtcggcattttggccatggaaacctacattccttcacaa
tatgtggaccaaacggacctggaagagttcgacggagtcgccgccgggaaatacactgtc
ggactcggccagagcaagatgggcttctgctctgacagagaagacatcaactctctggcc
atgactgtgcttcacaaactgattgagatgaacaacattgacctgcacgacattgggcgc
ctggaggtcggtacagagactattattgataaaagcaagagtgtaaagacatttctgatg
accttatttgctgaggcgggagccacagatattgagggcattgacacaacaaatgcttgc
tatgggggcacagctgctctgtttaatgccattaactgggtagaatcatcttcatgggat
ggacgaaaagctatagtggttgctggagatatagccgtgtatgggaagggcccggcgcgg
cccacaggaggggcaggagctgtggccatgctggtggggcctgatgcccctcttgtattt
gaccgcggtgtgagagcctcatacatgactcacgcctatgacttctacaagcctgacctg
gcatctgagttcccctttgttgatggaaagttatctatcaagtgctatctcagtgctcta
gacaactgttacaatttattttcaaagaagatgcgcagggatcagccagacttcaagggg
cttctgagtttagatgggatgctgttccactctccctattgcaaattggtgcagaaatca
cttgcacggatgtgtttcaatgacttcctaaatactccacctgaagatagagagaaacag
ttcccaggactatcagagtttagcaatcataagttagaggaaacatactttgaccgagat
gtagagaaagcatttatgacttatagtcaaaatctatttgaagaaaagactaaaccttca
ttgaatttagctcgtaatgtagggaacatgtacacagcctccctgtatggcagtctggct
tcatacctgatcagcaaatctcctgaagaacttgtggggaagaagtttgcactattctct
tatgggtcagggctatcatccaccatgtactccatacagatatgcaatgatgtgagtgct
ggttccaagttgcaaaggttgataagttcacttcatgactcaatatctctaatagataag
agggaatgtgtgaaacctcaaacattctcggacctgatggatgtgaggaccaagaactac
cacacggcaccctacgagccctctgggtccattgctgccctgttcccaggaacttactac
ctcgagaaaattgatgaccaaagaaggcgtacctatggaagaaaagaatag

DBGET integrated database retrieval system