KEGG   Plutella xylostella (diamondback moth): 105391115Help
Entry
105391115         CDS       T03915                                 

Definition
(RefSeq) IWS1-like protein
  KO
K17498  transcription factor SPN1
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pxy03021]
    105391115
Transcription machinery [BR:pxy03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105391115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 Pex19
Motif
Other DBs
NCBI-GeneID: 105391115
NCBI-ProteinID: XP_011560834
Position
Un
AA seq 743 aa AA seqDB search
MDVDTGGREGSPARSRSHSVESNSKMSHDGSVRSRSGSRSKSRSRSRNGSRKSGSRSRSG
SRKSRSRSRSGSRKSRSRSRSGSRKSRSRSGSAKSRSPSPGGAGSPKSPRKSRSRSKSKS
PANAGSRSGSKSKSRSRSRSGSRAKSRSRSGSPAKSRSRSGSRKSRSRSGSRARSGSRGR
SRSKSGSRARSGSRGKSRSKSGSRARSGSRAKSRSRSGSRARSGSRAKSRSRSGSRDKAA
EGTSRKSRSRSGSPDKVEKRKRSRSKSGSHSRSRSRSGSRRSRSGSRRSRSGSRSRSGSR
RSRSGSRRSRSGSRRSRSGSGSRRSRSGSRRSRSGSRRSRSGSRKSGSRSRSRSKSVGAD
GGRRKRSPSGSKSRSRSGSRKSRSRSRSRSGSRSRSRSGSGEPQTKKRRTVRLTSESGDE
APPAGDPPAGEGAAPAAPADDSSDDEVAPDSKSNEMAGGMTDFEIMLARKRDERKGRRRR
RDIDIINDNDDLIAQLLHDMRKAAEEDRELNKLSQPAVRKVSMLKKAMSQLIKKDLQLAF
LEHNVLNVLCDWLAPMPNRALPCLLIRESVLRLLCDFPAIDKSLLKQSGIGKAVMYLYKH
PKETKRNRERAGRLISEWARPIFNLSTDFKAMSRSERQARDEAMAGGRRPDKESTSKKEE
ERTGPVARPGEKGWVARARVPLPSNKDYVVRPKSTTDVDMSRVSKKKMTRYEKQMKRFLD
QKRMKSAHKGGFSTRRRDLHRGR
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggatacaggtggccgcgaaggcagtccagcacgctcacgtagtcactcggtg
gaatccaactccaaaatgtcccacgacgggtcggtgcgttcccggagcgggtcccggtcc
aaatcccgctccagatcccgaaatggatctcgaaaatctggctctagatcccgcagtgga
tcccgcaaatcccgctctagatcccgcagtggatcccgcaaatcccgctctagatcccgc
agtggatcccgtaaatctcgctctagaagcggctcagccaagtcccgcagcccgtcccca
ggaggagcagggtctcctaagtctcccagaaaatcccgtagcagatccaagtcaaagtct
cctgctaacgccgggtctagaagtgggtcaaagtctaaatcccgttcgcgatcgcgcagc
gggtccagagctaaatcaaggtccagaagtggatcgccggcgaagtccaggtccagaagt
ggttcaaggaagtctagatctaggagcgggtcgcgagctagaagcggatcgcggggcaga
tctagatctaaaagtggatctagggctaggagtgggtctcgaggaaaatctcggtccaaa
agtgggtctagagctagaagtggatctagagcaaagtctagatctcgtagtgggtccagg
gctagaagtgggtcccgagctaagtccaggtcgcgcagtgggtcccgggacaaagcagca
gaaggcaccagcagaaagagtcgctccagaagtggatctccagataaagttgaaaagaga
aagcggtcgaggtccaaatctggttcacacagtcgtagccgatctagatctggctcacga
aggtccagatctggctctagacggtcccgctccggctctcgctcccgatccgggtcccga
cgctcccggtccggatctagacgatccagatctggctctaggaggtctaggtctggatct
gggtcaaggagatctaggtctgggtctagacggtctaggtctggatctaggaggtctagg
tccggctcacgcaagtctgggtctcggtcgcgatcacgatcaaagtctgttggtgctgat
ggtggtcgccgcaagcgctctccttccggttcaaaatctagatccaggtccggatctaga
aagtctaggtctaggtctcgatctcgctccggatctcgctccagatctcgctcgggctcc
ggggaaccacagaccaagaagcgtcgcacagtccgtctgacgtcagagtcgggtgatgag
gctccccccgcgggggaccccccggcgggggagggggcggcccccgcggcccccgccgat
gacagctctgatgatgaagtggctccggattctaagagtaacgagatggcaggcggcatg
accgacttcgagatcatgttagctcgcaagcgagacgagcgcaagggacggagacgcaga
agagatatagacattatcaacgataatgatgatcttattgcgcaactccttcacgacatg
cgtaaagcagcagaagaagaccgagagctgaacaagttgtctcaaccggctgtcaggaag
gtgtccatgctgaagaaagctatgagccaacttattaagaaggacctccaactagccttc
ttagaacacaatgtcctcaacgtgctctgcgactggctcgccccgatgcctaatcgagcc
ctgccctgcctgctgattagggagagtgtgttgaggctgctgtgcgatttcccagccata
gacaagtcgctcctaaagcaatctggcatcggcaaagccgtgatgtacctgtacaagcac
cccaaggagacgaagcgcaaccgggagcgcgcgggaagactcatctccgagtgggcgcgc
ccgatattcaacctcagcaccgacttcaaagcgatgtctcgctcggagcggcaggcgcgc
gacgaggcgatggcgggcggacggagacctgataaagaatctacttctaagaaggaggag
gaacgaaccggcccggtggctcgtccgggtgaaaaaggctgggtggcgcgagccagagtg
cctctacccagcaacaaggactatgtagtgaggcccaagagcactactgatgtggatatg
agcagggtatcgaagaagaagatgactcgctacgagaagcagatgaagcggttcctggac
cagaagcgcatgaagagcgcgcataaaggtgggttctcgacgcgccgccgagatctccat
cgagggcggtaa

DBGET integrated database retrieval system