KEGG   Plutella xylostella (diamondback moth): 105396798Help
Entry
105396798         CDS       T03915                                 

Definition
(RefSeq) heat shock 70 kDa protein 4-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy03040  Spliceosome
pxy04141  Protein processing in endoplasmic reticulum
pxy04144  Endocytosis
pxy04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105396798
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105396798
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105396798
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105396798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pxy01009]
    105396798
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxy03041]
    105396798
   03009 Ribosome biogenesis [BR:pxy03009]
    105396798
   03110 Chaperones and folding catalysts [BR:pxy03110]
    105396798
   04131 Membrane trafficking [BR:pxy04131]
    105396798
   03051 Proteasome [BR:pxy03051]
    105396798
   03029 Mitochondrial biogenesis [BR:pxy03029]
    105396798
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxy04147]
    105396798
Protein phosphatases and associated proteins [BR:pxy01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105396798
Spliceosome [BR:pxy03041]
 Complex B
  Other components
   Prp19 complex
    105396798
 Complex C
   Prp19-CDC5 complex
    105396798
Ribosome biogenesis [BR:pxy03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105396798
Chaperones and folding catalysts [BR:pxy03110]
 Heat shock proteins
  HSP70 / DNAK
   105396798
Membrane trafficking [BR:pxy04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105396798
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105396798
Proteasome [BR:pxy03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105396798
Mitochondrial biogenesis [BR:pxy03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105396798
Exosome [BR:pxy04147]
 Exosomal proteins
  Proteins found in most exosomes
   105396798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Asp_decarbox DDR
Motif
Other DBs
NCBI-GeneID: 105396798
NCBI-ProteinID: XP_011567107
Position
Un
AA seq 244 aa AA seqDB search
MSAEYEGAIGIDLGTTYSCVGVWESERVEIIANEQGNRTTPSYVAFSDSERLVGDAAKNQ
AAMNPKNTVFDAKRLIGRRFDDADVKADMKNWPFTVVDKETAPFIQVEFEGETKTYSPQE
ISSMVLIKMKEIAEAKIGKKVTKAVVTVPAYFNDSQRQATKDAGTISGLDVLRIINEPTA
AAIAYGLDANDKKERNVLIYDLGGGTFDVSLLTISGGVFAVKATAGNTHLGGEDFDNTLV
NHFV
NT seq 733 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgaatacgagggtgccattggtatcgatttgggtactacctactcctgtgtt
ggtgtttgggaatccgagcgtgtcgaaatcattgctaacgagcaaggtaaccgtaccact
ccttcttatgttgctttctccgactctgaacgtctcgtcggtgatgccgccaagaaccaa
gctgccatgaaccccaagaacaccgtcttcgatgctaagcgtcttattggtcgccgtttc
gatgatgccgatgttaaggctgacatgaagaactggcctttcaccgttgttgacaaggaa
accgctcccttcattcaagttgaattcgaaggtgagaccaagacttactctcctcaagaa
atctcttccatggtcctcatcaagatgaaggaaatcgctgaagccaagattggtaagaag
gtcaccaaggccgttgtcaccgtccctgcctacttcaacgacagtcaacgtcaagccacc
aaggatgccggtaccatttctggtctcgatgttctccgtatcatcaacgaacccactgcc
gctgctattgcttacggtttggatgccaacgacaagaaggaacgtaacgtcctcatttac
gatttgggtggaggaaccttcgatgtttccctcttgaccatttccggtggtgttttcgct
gtcaaggctaccgctggtaacactcacttgggtggtgaagatttcgataacactcttgtc
aaccacttcgttc

DBGET integrated database retrieval system