KEGG   Plutella xylostella (diamondback moth): 105397717Help
Entry
105397717         CDS       T03915                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00450  Selenocompound metabolism
pxy00970  Aminoacyl-tRNA biosynthesis
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105397717
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105397717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxy01007]
    105397717
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pxy03016]
    105397717
Enzymes [BR:pxy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105397717
Amino acid related enzymes [BR:pxy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105397717
Transfer RNA biogenesis [BR:pxy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105397717
 Prokaryotic type
   Other AARSs
    105397717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 tRNA-synt_1 GST_C_2 GST_C GST_C_3 GST_C_6 Glutaredoxin2_C tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 105397717
NCBI-ProteinID: XP_011568041
Position
Un
AA seq 877 aa AA seqDB search
MKIYTNENNTSTLKLLIAANLAGKKVELKNANFGEPLFAGPRSLPLLEVDEELLFFSSNA
AAQYLMPVLDLSQNGRCQQMQEWEATRLLPATLSAVTGKPAPELRQLLTSLLTDIDAVLT
KKKYILGDKLSAADISIWSTLYPLYYNATHKTTYLDATKNIQKWFEDIAAAKAVQEAVKQ
WGGSAQGPFGAPSALGLPQVPSLVATAQSPEEPVEVGPTPEEIELAEENWKHGLERLQPK
LEQGKVILPIKGRKNILITSALPYVNNVPHLGNIIGCVLSADIFARYCRLCDYNTLYISG
TDEYGTATETKALEEGVTPREICDKYFAIHNSVYRWFNIGFDHFGRTSTAEQTEITQKMF
LKLQDNGFISKKSVDQLYCQQCSRFLADRFVEGVCHHPGCLYPDARGDQCDKCGKLINAT
ELVNPRCKVCGDSPIIRASEQLFIELNQLEPSIRAWSDKASAGWAGGARAVLRAWLKETL
RPRAVTRDLKWGVPVPNYPDKVFYVWFDAPLGYMSITQSATKDYEKWWRPDKECDVKLYQ
FMAKDNVPFHALMFPAALLGVNEGHLLVHHIYSTEYLNYEEGKFSKSRGVGVFGTDAQDT
GIPADVWRFYLASIRPESSDSSFSWAELGTKNNSELLNNLGNFCHRSLSFCYNSFKGAVP
DVNPGPEEYELMALVNRELIAYVTEMSQGRLRFALRRVLSISRLGNQRMQAAQPWILLKG
TDEDKIRGATTIGLCCQIAALLCADELLSTSGLGKLPGTFKIQLEKNASPTVCPVRKIPI
GVRDKLLDALNNMVKLGVIRKVSHPTAWVNGIVLAPKKSGELRVCLDPRPLNRVIRRAHY
PLPTLTDIATKLQGARYFSKLDAPELNPEGSIPEVQG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctatactaacgagaataatacttctacgctaaagttgctaattgcagctaac
ttggctggtaaaaaagttgaactgaaaaatgcaaatttcggagagcccctatttgcaggc
cctcgctcgctgccactgcttgaggtggacgaggagctcttgttcttctccagcaatgcg
gccgcgcagtacttgatgcctgtgctggacctgtcgcagaatggacggtgccaacaaatg
caagagtgggaagccacgcggctcctcccggccacgctgtcagcagtcaccggcaaaccg
gcaccggagctgcgtcagctgctgacatctctgttgacagatatagacgcggtgctgaca
aagaagaagtatatacttggggacaaactgtcagcggctgacatatcaatctggagcacc
ctgtacccgctgtactacaacgcgacacacaagaccacgtacctggacgcgaccaagaat
attcaaaaatggtttgaagatatcgctgcggctaaggctgttcaagaagcagtaaagcag
tggggcggctcagcacagggcccgttcggcgcgccctccgctctcgggctgccacaggtg
ccgagtctagtggcgactgcgcaatcaccagaagagccagtggaggtgggtcccacgccc
gaagagattgaactagctgaagagaactggaagcacgggctcgagcgactgcaaccgaaa
ctagagcaagggaaggttatcctacccataaaaggccgcaagaacattctgatcacctcg
gctcttccctacgtgaacaacgtgccacatctgggcaacatcatcggatgtgtgctgtct
gcggacatattcgcacgatattgccggctctgtgactacaacacgttatacatatctgga
acagatgaatatggcacagctactgagactaaggcattagaagaaggtgtaaccccccga
gagatatgcgacaagtacttcgcgatccacaacagcgtgtaccgctggttcaacatcggg
ttcgaccacttcggccgcaccagcaccgccgaacagaccgaaataacacagaagatgttc
ctgaagctccaggacaacggcttcatcagcaagaagtccgtcgaccagctgtactgccag
cagtgcagccgcttcctcgctgacaggttcgtagaaggcgtgtgccaccaccccggctgt
ctgtaccccgacgccagaggggaccagtgcgacaagtgcgggaaactgatcaatgccacc
gaactggtcaacccacggtgtaaggtgtgtggagactcgccaataatcagagccagtgaa
cagctgttcatcgagttaaatcagctagaaccatcaatccgcgcctggtccgacaaagcg
tcggccggctgggcgggcggcgcgcgcgccgtgctgcgagcctggctcaaggagacgttg
agacctcgagctgttactagagacttgaagtggggagtgcctgtgcctaactacccggat
aaggtgttctacgtgtggttcgacgcgccgctcggctacatgagcatcactcagagtgct
actaaggactacgagaagtggtggagaccagacaaggagtgtgacgtgaaactctaccag
ttcatggcgaaagacaacgttccgttccacgcgctgatgttcccggcggcgctgctcgga
gtcaacgagggacacctcctcgtgcaccacatctactccaccgaatacctgaactacgaa
gaaggaaagttctcgaaatcaagaggcgtcggcgtttttggcacagatgctcaggacacg
ggtataccagcggacgtgtggcgcttctacctggcgagcatccggcccgagtcttcggac
tccagcttcagctgggccgaattggggactaaaaacaactcggagctgctaaacaatctg
ggcaacttctgccaccgctcgctcagcttctgctacaactcgttcaagggtgccgtcccg
gatgtgaacccgggaccggaggagtatgagctgatggcgctagtgaacagggagcttatt
gcctacgtaaccgagatgtcccaaggccgcctccgcttcgctctgcgccgagtcctgtcc
atatcccggctcggcaaccagcgcatgcaggctgcgcagccgtggatactgttgaaggga
actgatgaggacaagatccgcggcgcgacaacgataggcctgtgctgccagatcgccgct
ttactctgcgcggatgaattattatcaacttccgggttagggaagttgcctgggactttt
aaaattcaactagaaaagaatgcgagtccgacggtgtgccctgtcaggaaaatacctatc
ggtgttagggacaagttattagatgccttaaataacatggtaaagttgggagtaattcgg
aaggtgagtcacccgaccgcgtgggtcaacggcatcgtgctggcgcccaagaagagcggc
gagctgcgggtgtgcctcgacccgcgcccgctcaaccgcgtcatccggcgcgcgcactac
ccgctgcccacgctcacggacatcgccaccaagctgcagggggccaggtacttcagtaag
ctagatgctccggaattgaaccccgagggttcaattccggaggttcagggataa

DBGET integrated database retrieval system