KEGG   Plutella xylostella (diamondback moth): 105397880Help
Entry
105397880         CDS       T03915                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00010  Glycolysis / Gluconeogenesis
pxy00562  Inositol phosphate metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105397880
   00562 Inositol phosphate metabolism
    105397880
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105397880
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105397880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105397880
NCBI-ProteinID: XP_011568192
Position
Un
AA seq 236 aa AA seqDB search
GYVTAQHLAQAWRRRYPGLLTDNRHDYLFKYLNDRRSTSSFRAYTEGLFRAQAQDQDIPN
ASDEKLLTPYKFCPAWTKDVEQNNETTSYQLIFESKQEYRDMINNISLRLGFNYEIDKES
IKRMYQMCRYNKAWDIAQISPWCAAFTKSDLQRLEYAEDLETYYKYGYGSPINQKLGCGL
VKDMFDFFQHQIESGDIPQQPRAKIYFTDAPTLLLTLTSLGAHRQVTPLTGDNYRT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ggctacgtcaccgcgcagcacctggcgcaggcctggaggcggcgctacccggggctcttg
actgacaatagacatgactacttgttcaagtacctgaacgaccggagatcgacgagctca
ttccgcgcgtacacggagggtctcttccgtgcgcaggcgcaggaccaggacataccgaat
gctagcgacgagaaattgttaacgccctacaaattctgtccagcgtggacgaaagatgtg
gaacagaataacgagaccacatcctaccagctgatctttgaatccaagcaggagtacaga
gacatgatcaacaacatatccctccgtttagggttcaactatgagatagacaaggagagc
atcaagcgaatgtaccagatgtgcagatacaacaaggcgtgggacatcgcgcagatatcg
ccgtggtgcgctgctttcactaagagtgatctgcaacgtctagaatacgcagaggaccta
gagacctactataaatacggctacggctctccgatcaaccagaaactcggctgcggttta
gttaaagacatgttcgacttcttccagcatcaaattgaaagtggagacatcccccaacag
ccccgagcaaagatctacttcacggacgctcccaccctgcttctcactctcacatcactc
ggcgctcaccggcaagtcactccgctgactggcgacaactaccggaca

DBGET integrated database retrieval system