KEGG   Plutella xylostella (diamondback moth): 105398137Help
Entry
105398137         CDS       T03915                                 

Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy04068  FoxO signaling pathway
pxy04144  Endocytosis
pxy04350  TGF-beta signaling pathway
pxy04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    105398137
   04068 FoxO signaling pathway
    105398137
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105398137
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105398137
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxy01001]
    105398137
Enzymes [BR:pxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     105398137
Protein kinases [BR:pxy01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   105398137
Cytokine receptors [BR:pxy04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   105398137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp APH Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 105398137
NCBI-ProteinID: XP_011568494
Position
Un
AA seq 505 aa AA seqDB search
MHLYKNVLMDTLYRRKWFIIFILSVYRRLDPVEGLKCYCNSQSESCPNETCETDGFCFAS
TSRRDGRQHYTFQCWGRSSVFPPGDWPIWCRAHEAPEQVFCCATDLCNRAFVAPESSPSA
GTWHVIPWVMGLAVLFTCAALSLWWAKRSRNLMKRGSRPLFSGEDSMCETRHPIMGTATI
RDMIELTTSGSGSGLPLLVQRSIARQIQLADIIGKGRFGEVWRGRWRGENVAVKIFSSRE
ECSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLITDYHENGSLFDFLTARTID
TNTLIKMALSIATGLAHLHMDIVGTKGKPAIAHRDLKSKNILVKSNLSCVIGDLGLAVRH
NVAADAVDVPSTNRVGTKRYMAPEVLDETMDTRQFDPYKRSDVYSFGLVLWETARRCGAL
PDEYQPPYYDCVPSDPALEDMRRAVCVERRRPNVPNRWHSDPVLSAISKVMKECWYQNPA
ARLTALRIKKTLANIAEGEQVVLKM
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcatttatacaagaatgtgttaatggatactttatatcgccgtaaatggttcatcatc
ttcatactgtcggtttaccggagattggaccccgtggaaggtttgaaatgttactgcaac
agtcagagcgagagttgtcccaacgagacgtgtgagacggacgggttctgcttcgcgtcg
acctctaggcgcgacgggcgccagcattacaccttccaatgttggggccgctcgagcgtg
ttccccccaggcgactggcccatctggtgccgcgcgcacgaggcgcccgagcaggtgttc
tgctgcgccaccgacctgtgtaaccgcgccttcgtcgcgccagagtcgagcccgtcagcg
ggcacatggcacgtcatcccgtgggtgatgggtctggcggtcctattcacttgcgcggcg
ctcagcctgtggtgggccaagcgctcgcgtaacctgatgaagcgaggctcaagaccgctg
ttctccggcgaggattccatgtgcgagacgagacaccccatcatgggcacggctacgatc
agggatatgattgagttgactacttcggggtctggctctgggctaccactgttggtgcag
cggtccatcgcgcgacagatccagctagcggacatcatcggcaagggtcgcttcggcgag
gtctggcgcggccgctggagaggcgagaatgtcgccgtcaagatattctcgtccagggaa
gaatgctcctggtttcgtgaggccgagatctaccagaccgtcatgctgcgccacgagaat
atcctcggatttattgctgctgataataaagacaacggcacatggacgcagctgtggctg
atcacagactatcacgagaacggttcattattcgacttcctgacggctcgcaccatagac
acgaacactctcatcaagatggcgctctccatcgcgacgggactcgctcatttgcacatg
gatatagtcggcactaagggcaagccggccatagcgcaccgcgacctcaagtccaagaac
atcctggtgaagagcaacctgagctgcgtgatcggcgacctcgggctggcggtgcggcac
aacgtggccgcggacgccgtcgacgtgccctccaccaaccgcgtgggcaccaagcggtac
atggcgcccgaggtgctagacgagacaatggacacgcgtcaattcgacccgtacaagcgg
tcagacgtgtactccttcggcctagtcctctgggagacagctcgtcgttgtggcgcctta
cctgatgaataccagccgccgtactacgactgcgtgccttcagaccctgcgcttgaggat
atgaggcgcgccgtgtgtgtggagagacgacggccgaatgtgcctaatcggtggcactcg
gatcctgtcctgtcagcgatatcgaaggtgatgaaggagtgctggtaccagaacccggcg
gcgcggctgacggctctgcgcatcaagaagaccctcgccaacatcgccgagggggagcaa
gtggtgctcaagatgtag

DBGET integrated database retrieval system