KEGG   Pyrococcus yayanosii: PYCH_05820Help
Entry
PYCH_05820        CDS       T01543                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00220  Arginine biosynthesis
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01130  Biosynthesis of antibiotics
pya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PYCH_05820
Enzymes [BR:pya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PYCH_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AEH24270
UniProt: F8AI43
Position
complement(482776..483723)
Genome map
AA seq 315 aa AA seqDB search
MVVSLAGRDLLCLQDYTAEEIWTILETAKMMKIWQKIGKPHRLLEGKTLAMIFQKPSTRT
RVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMARVYDHKDVEDLAK
YASVPVINGLSDFSHPCQALADYMTIWEKKGHIAGLKVVYVGDGNNVAHSLMIAGTKLGA
HVVVATPEGFEPDEKVIKWAEANAAESGGSFELLHDPIKAVKDADVIYTDVWASMGQEAE
AEERRRIFRPFQVNKDLVKHAKPDFLFMHCLPAHRGEEVTDDVIDGPNSVVWDEAENRLH
AQKAVLALLMGGIKG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgagccttgcaggaagggaccttctctgcctccaggactacacggccgaggag
atatggacgattctcgagacggccaaaatgatgaagatttggcagaagataggcaagccc
cacaggctccttgagggcaagaccctggcaatgatattccagaagccctccacgaggaca
agggtgagctttgaggttgccatggcacacctcggcggccatgccctctacctcaacgcc
caggacctccagctccgcaggggcgaaacgatagccgacaccgcccgcgtcctcagccgt
tacgtggatgccataatggcgagagtttacgaccacaaggatgttgaagacctcgccaag
tacgcaagcgttccggtgataaacggtctatctgacttttctcacccgtgccaggcttta
gcggactacatgacaatatgggagaagaagggccacatagctggcctcaaggttgtctac
gtcggcgacggaaacaacgtagcccattcgctcatgatagccggaaccaagcttggcgct
cacgtcgtcgttgcaacgccagagggcttcgagcccgacgagaaggtcatcaagtgggcc
gaggctaacgcggccgagagcggtggaagcttcgagctcctccatgacccaattaaggcc
gtcaaagatgcggacgtcatttacactgatgtttgggcgagcatgggacaggaggcagag
gccgaggagaggaggagaatctttaggccgttccaggttaacaaggacctagtaaagcac
gcaaagccggacttcctcttcatgcactgccttccggcccacaggggcgaggaggtcacg
gacgacgtcatagatgggcccaacagtgtggtctgggacgaagcggagaacaggctccac
gcccaaaaggctgtgcttgccctgctgatgggtgggattaagggctga

DBGET integrated database retrieval system