KEGG   Pyrococcus yayanosii: PYCH_09300Help
Entry
PYCH_09300        CDS       T01543                                 

Definition
(GenBank) glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
pya  Pyrococcus yayanosii
Pathway
pya00630  Glyoxylate and dicarboxylate metabolism
pya01100  Metabolic pathways
pya01110  Biosynthesis of secondary metabolites
pya01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PYCH_09300
Enzymes [BR:pya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     PYCH_09300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN AdoHcyase_NAD PDH AlaDh_PNT_C NAD_binding_7 Rossmann-like XdhC_C
Motif
Other DBs
NCBI-ProteinID: AEH24615
UniProt: F8AEA4
Structure
PDB: 

Position
complement(820265..821266)
Genome map
AA seq 333 aa AA seqDB search
MKPKVLITRAIPENGIELLREHFEVEVWEHEHEIPREVLLEKVKDVDALVTMLSEKIDRE
VFDAAPRLRIVANYAVGYDNIDIEEATKRGIYVTNTPDVLTDATADLAWALLLAAARHVV
KGDKFVRSGEWKRRGIAWHPKMFLGYDVYGKTIGIVGFGRIGQAIAKRAKGFGMRILYTA
RSRKPEAEKELGAEFKPLEELLRESDFVVLAVPLTKETYHMINEERLRLMKPTAVLVNVA
RGKVVDTKALIRALKEGWIAAAGLDVFEEEPYYDEELFALDNVVLTPHIGSATFGAREGM
AELVAKNLIAFKNGEVPPTLVNREVLKVRRPGF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaaggtcttaataacacgggccattcccgagaacggcattgagcttctcagg
gagcactttgaggtggaagtctgggagcacgagcacgagattccaagggaggttctcctc
gagaaggtcaaagatgtggatgccctcgtaacgatgctcagcgagaagatagatagagag
gtttttgacgccgctccccgcctgagaatcgtcgccaactacgccgtcggttacgacaac
atagacatcgaagaggccaccaaaaggggaatctacgttacgaacacgcccgacgtcctg
accgatgcaacggcggacctcgcatgggcactcctgctggcggcggcgaggcacgttgtg
aagggagacaagttcgtccgctccggcgagtggaagagaaggggaattgcatggcatccc
aaaatgttccttggttatgacgtctacggcaagaccatcggaatagtgggctttgggagg
atagggcaggcgattgccaagagggctaagggctttggcatgcgcattctctacacggcg
aggagcaggaagccggaggccgagaaggagctcggggctgagttcaagcctctggaggag
ctcctcagggagagcgacttcgtcgttttggcagttcccctcacgaaggagacatatcac
atgataaacgaggagcggctcaggcttatgaagccaaccgcggtgctcgtgaacgtggct
aggggcaaggtcgttgacacgaaggccctaatcagggcccttaaagagggctggatagcg
gcggctggcctagatgtcttcgaggaggagccctactacgacgaggagctcttcgccctc
gacaacgtcgtcctaacgcctcatatagggagcgcgaccttcggtgcaagggaaggcatg
gccgagctcgtcgcaaaaaatttgatagccttcaagaacggcgaggttccgcccacgctc
gtcaatagagaggtgctgaaggtgaggaggcctggcttttaa

DBGET integrated database retrieval system