KEGG   Pyrococcus kukulkanii: TQ32_00315Help
Entry
TQ32_00315        CDS       T04365                                 

Definition
(GenBank) digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
pyc  Pyrococcus kukulkanii
Pathway
pyc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TQ32_00315
Enzymes [BR:pyc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     TQ32_00315
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     TQ32_00315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl DAO FAD_binding_2 FAD_oxidored Trp_halogenase Pyr_redox_2 HI0933_like NAD_binding_8 3HCDH_N Thi4 GIDA DUF596 Citrate_bind SE GDI
Motif
Other DBs
NCBI-ProteinID: AMM53108
UniProt: A0A127B771
Position
60358..61539
Genome map
AA seq 393 aa AA seqDB search
MRYDVVVVGSGVAGPIVARNVAKAGFSVLLVDKKPAIGTPKQCAEGINVNIFKEFEIPYD
KRFINREIYGARIYSPSGYTAELRYKDVSGVILERKVFDKMLAYYAAKAGAEVLARTEVV
DVLRDGGKIVGVKAKHEGEPLEIKADVIVAADGVESTVARKAGINTYAPPHEFDSAYEYE
MLIEGYDPDLIHLWFGTEIAPRGYVWVFPKDEDRANVGIGINSDNEKTAKYYLDKWLKEN
NIPRNKILEVNVGLVPVGGFVKELVKDNVLVVGDAARQVNPVHGGGMYEAMKAATMAAKW
IVEALEEENMELLKNYTKEWWEREGPKMEKLLKLRRAMEKLTDEDIDVFVQLLSGTDLEK
LASGNYLEVVKALMKHPKVLMSKRRLEILRALI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgatgtcgtcgtcgttggttcaggtgttgccggccctatcgttgctaggaac
gtggctaaagctggtttctccgttcttctagtcgataaaaagcccgcgattggaacccca
aagcagtgcgcagaggggataaacgttaacattttcaaggagtttgaaattccttatgac
aagaggttcattaacagggagatttacggggcaaggatttactctccaagcggttacacc
gcggagcttaggtataaggatgtcagcggtgttatacttgagaggaaggtttttgataag
atgctcgcctattatgcagccaaggctggtgctgaggttctcgctagaaccgaggtagtt
gacgttctgagggatggcggtaagatagttggcgtgaaagccaagcatgagggcgagccc
ttagagattaaagcagatgtaatagttgcagctgacggcgttgagagtaccgtggcgaga
aaggctggaataaacacatacgctcctccacacgagtttgattccgcctacgaatacgaa
atgctgatagagggctacgatcctgacttaattcacctatggtttggcaccgagatagct
cctcggggttacgtctgggtcttccccaaggacgaagatagggccaatgtgggcattggc
ataaactcggacaatgagaaaactgcaaagtactatcttgacaagtggcttaaggagaac
aatatccccagaaacaagatcctcgaggtcaacgttggcctagttccagttgggggtttc
gttaaggagttggttaaggacaatgttctcgtggttggagatgcggcaaggcaggtcaat
ccagttcacggtggtgggatgtacgaggccatgaaggccgcaactatggcggcaaagtgg
atcgttgaggccttagaggaagagaacatggagttgctcaagaactacacgaaggagtgg
tgggaaagggaggggccaaagatggagaagttgctaaagctcaggagggcaatggagaag
cttacggatgaagacatagatgtgttcgttcaactgctgagcggaactgatctagaaaag
ctagctagcggtaactaccttgaggttgttaaggccttaatgaagcatccaaaagtgtta
atgagcaagagaaggctggaaatccttagggccctgatatga

DBGET integrated database retrieval system