KEGG   Pyrococcus kukulkanii: TQ32_04670Help
Entry
TQ32_04670        CDS       T04365                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pyc  Pyrococcus kukulkanii
Brite
KEGG Orthology (KO) [BR:pyc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TQ32_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMM53853
UniProt: A0A127B8Z9
Position
complement(884359..885579)
Genome map
AA seq 406 aa AA seqDB search
MIADPWVFFTIILGLAMAWAIGANDAANSMSTAVGAGAITPKQAVLIAGVLEFTGAYFFG
KSVTETIRKGIIDPSKINDPNVLIYGSIAALLGATIWLIIATKYGLPVSTTHSIIGGIVG
YGIVYAGASIVNWSKMAKVVMSWILSPIVGAIFAFLVFKALSKTVLQSGDPIKSAKRWSP
FWIGLAFVVIGTMFYLKVLHGKSLIVGFVKFGIPAGIVAFIIVSLILRVRFPNVDPYLGA
EAIFRKVQVITSGYVALAHGANDVANAIGPVAAVYTIATMGMAGAKVPVPRWILALGGLG
IAIGVATYGYRVMETVGKKITELTNTRGFTIDFSAATVVLIASWLGMPISTTHTVVGAVI
GVGLARGIKAINKDIVKDIVISWFVTVPTAGVISAIIFKALMLIVG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggatccctgggtgtttttcacgataattttaggtctggccatggcatgggca
atcggagcaaatgatgccgcaaattcaatgagtaccgccgttggtgcaggtgcaataacc
ccaaagcaggcagttttaattgcgggagtgctagaatttactggagcttacttcttcggt
aagagcgttacagaaaccataaggaagggaataattgatccatcaaagatcaatgatcca
aatgttctaatttatggatcaatagcagccctccttggagcgacgatctggctcataatt
gcgacaaagtacggactccccgtatcaacaacgcactcaattattggaggaatagtaggt
tatggaattgtgtatgcgggagcatcaatagttaactggagcaagatggccaaggttgta
atgagttggattctctccccaatagtgggagcaatctttgcattccttgtattcaaagcc
ctcagcaaaacggttctacaaagtggagatcctataaaaagtgcaaaaagatggtctccg
ttttggatagggctggccttcgtcgtcataggaactatgttctaccttaaggttctacac
gggaagtccctcattgtcgggttcgttaagttcggtattccagccggaattgtggctttt
attatagtatccctaatcctaagggttaggttcccaaacgtcgacccatatctcggggca
gaggccatattcaggaaagttcaggtgataacttcaggttacgttgcactcgcccacgga
gcaaatgatgtcgccaacgccataggccccgttgctgccgtatacaccatagcaacgatg
ggaatggcgggggcaaaagttccagtccccaggtggatattggccttaggtggtcttggg
atagcaatcggtgtagcaacttacggttacagggtgatggagacagttggaaagaagatt
acggagctcacgaatacaagaggattcacgatagatttctccgcggccaccgttgtccta
atagcgagctggcttggcatgccaatctcaacgacgcacaccgtagtcggtgccgttatt
ggagttggacttgccaggggaataaaggcaataaataaggacatagtaaaggacatagtg
atctcgtggttcgttaccgttcccactgcaggtgtaatttcggctataattttcaaggca
ttgatgctgattgtggggtga

DBGET integrated database retrieval system