KEGG   Paracoccus yeei: A6J80_00760Help
Entry
A6J80_00760       CDS       T04781                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
pye  Paracoccus yeei
Pathway
pye02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pye00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A6J80_00760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pye02000]
    A6J80_00760
Enzymes [BR:pye01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     A6J80_00760
Transporters [BR:pye02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    A6J80_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 AAA AAA_30 DUF815 AAA_16 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ARC35071
UniProt: A0A1V0GMK4
Position
unnamed2:complement(149714..151228)
Genome map
AA seq 504 aa AA seqDB search
MTDPALLTARGIDKAFFGVKVLDGVDFTLHPGEIHALLGENGAGKSTLVKILTGAYRRDD
GAMQLEGAEVEPRSVAEAQALGIGTVYQEVNLLDNLTVAENLYLGRQPRRWGMIDRRRMR
ARAGALLARYGIAADPDETLARYSVAVRQIIAIARAVDLSGKVLFLDEPTASLDAREVQA
LFTVLKQLRDQGLGIVIITHFLDQVYQVADRVTVLRNGRMVGSRRLADLPRRDLVALMLG
RELAEATAHRDPGAGNPGDTPAAFRFEGYGKRGSVAPFDLAIRAGEVVGIAGLLGSGRTE
TARLMFGIDRPDSGRALVDDRPVALTSPEEAISLGFGMCPEERKTDGIVGDLSVSQNIAL
ALQARRGWARPIPRREADALARRYIKALDIRPPDPDRPIKFLSGGNQQKAILARWLATDP
RLLILDEPTRGIDIGAHAEIIALIERLRADGMALVVISSEIEELVAYSTRVIVLSDRQHV
RELRGADISAQAIVEAMAVPGEAA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggcgctgctgaccgcacggggaatcgacaaggcattcttcggcgtgaag
gtgctggacggcgtcgatttcaccctgcatcccggagagatccatgccctgctgggtgaa
aacggcgcgggcaagtccacgctggtcaagatcctgaccggcgcctatcgccgcgacgac
ggcgccatgcagcttgagggtgccgaggtcgagccgcgatccgttgccgaggcgcaggcc
ctgggcatcggcacggtctatcaagaggtcaacctgctcgacaatctgacggtggccgag
aacctgtatctgggccggcagccccgccgctggggcatgatcgaccgccgccggatgcgg
gcccgcgccggcgcgctgctggcccgctatggcattgccgccgacccggacgaaaccctg
gcccgctattccgtggccgtgcgccagatcatcgccatcgcccgcgcggtggatctgtcg
ggcaaggtgctgtttctggacgaacccaccgcaagcctggacgcgcgcgaggtacaggcg
ctgttcaccgtcctgaaacagttgcgcgaccagggcctgggcatcgtcatcatcacccat
ttcctggatcaggtctatcaggtcgccgaccgcgtgacggtgctgaggaacggccgcatg
gtcggcagccgccgcctggcggacctgccccgccgcgatctggtggccctgatgctgggc
cgcgaactggccgaggcgacggcgcatcgcgaccccggcgcgggcaaccccggcgacacg
ccggccgccttccggttcgaaggctacggcaagcgcggctcggtcgcgcccttcgacctg
gcgatccgcgcgggcgaggtggtggggatcgcggggcttctgggctcggggcgcaccgag
acggcgcggctgatgttcgggatcgaccgccccgacagcggccgcgcgctggtcgacgac
cgccccgtcgccctgacctcgcccgaagaggcgatctcgctgggcttcggcatgtgcccc
gaggaacgcaagaccgacggcatcgtgggcgacctgtcggtaagccagaacatcgcgctg
gccctgcaggcccggcgcggctgggcccgccccatcccccggcgcgaggcggatgcgctg
gcgcggcgctatatcaaggcgctggacatccgcccgcccgaccccgaccggccgatcaag
ttcctgtccggcggcaaccagcaaaaggcgatcttggcgcgctggcttgcgaccgacccg
cgactgctgatcctggacgagccgacgcgcggcatcgacatcggcgcacatgccgaaatc
atcgccctgatcgagcggctgcgcgccgacggcatggcgctggtcgtcatctcctcggaa
atcgaggagctggtcgcctattccacccgcgtcatcgtgctgtcggaccgccagcacgtc
cgcgaactgcggggcgccgacatctcggcccaggccatcgtcgaggccatggccgtgccc
ggagaggccgcatga

DBGET integrated database retrieval system