KEGG   Paracoccus yeei: A6J80_02575Help
Entry
A6J80_02575       CDS       T04781                                 

Definition
(GenBank) TenA family transcriptional regulator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
pye  Paracoccus yeei
Pathway
pye00730  Thiamine metabolism
pye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A6J80_02575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pye03000]
    A6J80_02575
Enzymes [BR:pye01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     A6J80_02575
Transcription factors [BR:pye03000]
 Prokaryotic type
  Other transcription factors
   Others
    A6J80_02575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ARC35415
UniProt: A0A1V0GNK4
Position
complement(28480..29127)
Genome map
AA seq 215 aa AA seqDB search
MTERFTETLRRASEPDWSAAVQHRFVRELCDGTIPDAVMGAYLVQDHRFLDAFLTLLGGA
IASADGFQARLRLGRFAGMVSGDENDYFLRSFAALGISDAARAAIPDSAPTAGSQAIMRE
AAATRSYAAILAVLTVAEWLYLDWASRAPRPLPGTFVHAEWITLHDNPFFRDFVAFLRDE
LDRVGPGAEAQARDFFTRAVALERAFFDAAYTSAS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcttcaccgaaaccctgcgccgcgccagcgagcccgactggtcggccgcc
gtgcagcaccgcttcgtgcgcgagctgtgcgacggcaccatcccggacgcggtgatgggc
gcctatctggtgcaggatcaccgctttctggacgcgttcctgacgctgctggggggcgcc
atcgcctcggccgacggtttccaggcgcggctgcgccttggccgctttgccggcatggtc
tcgggtgacgagaacgactatttcctgcgcagcttcgcggcgctgggcatttcggatgcg
gcgcgggccgcgatccccgacagcgcgccgacggccgggtcccaggcgatcatgcgcgag
gcggcggcgacgcggtcctatgcggcgatcctggcggtgctgaccgtggcggaatggctg
tatctcgactgggcgtcgcgcgccccccggcccctgcccgggaccttcgtccatgccgaa
tggatcaccctgcacgacaacccgttctttcgcgacttcgtggcctttctgcgggacgag
ctggaccgcgtgggaccgggggccgaggcgcaggcgcgggatttcttcacccgcgccgtc
gccttggagcgcgccttcttcgacgcagcctataccagcgcgtcctga

DBGET integrated database retrieval system