KEGG   Paracoccus yeei: A6J80_02640Help
Entry
A6J80_02640       CDS       T04781                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pye  Paracoccus yeei
Pathway
pye00260  Glycine, serine and threonine metabolism
pye01100  Metabolic pathways
pye01110  Biosynthesis of secondary metabolites
pye01120  Microbial metabolism in diverse environments
pye01130  Biosynthesis of antibiotics
pye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A6J80_02640
Enzymes [BR:pye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A6J80_02640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARC35426
UniProt: A0A1V0GNJ0
Position
complement(45701..46732)
Genome map
AA seq 343 aa AA seqDB search
MNFASDNAWGAHPAVLKALSDCNEGAVGSYGADPVTARAEAAIRDLLDAPQAVVRFVATG
TAANALVCAQLSPPWGRVYCHDSAHIHRDECAAPEFFSNGAKLVPIPGDHGRIGPDALGQ
AIRAGATGSLNDGAGALVSITNATEWGTVYAPADVAALAGVARDAGLRLHMDGARFANAV
AGLDCAPADLVRGVDALCLGGTKNGALAAEAAVFFDPALAQGFDYRRKQSGHVFSKQRYL
AAQMLALMTGGLWLDLARHANAMAARLGQGLARSGAELLAPVQANEVFARIAPEAHAAAR
AQGAVYHLWQDVPPGPGEPVAIRLVTSWATRDEDVDRFLDLIG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcctccgacaacgcctggggcgcgcatccggcggtgctgaaggccctgtcc
gattgcaacgagggcgcggtcgggtcctatggcgccgatcccgtcaccgcccgcgccgag
gcggcgatccgcgatctgctggacgcgcctcaggcggtggtgcgctttgtcgccaccggc
acggcggccaatgcgctggtctgcgcgcagctgtcgccgccctggggccgggtctattgc
cacgacagcgcccatatccaccgcgacgaatgcgccgcgcccgagttcttttcgaatggc
gcgaagcttgtgccgatcccgggcgaccacggccggattgggccggatgccttgggccag
gcaatccgtgcaggggccacgggcagcctgaacgacggcgcaggcgcgctggtgtcgatc
accaatgcgaccgaatggggcacggtctatgcgccggccgatgtcgcggcgctggccggg
gtggcgcgggatgcgggcctgcggctgcatatggacggggcgcggttcgccaatgcggtc
gcgggtctggactgcgcgcccgccgatctggtgcggggcgtcgatgcgctgtgcctgggc
gggaccaagaacggcgcgcttgcggccgaggcggcggtgttcttcgaccccgcgctggcc
caggggttcgattaccggcgcaagcagtcgggccatgtgttttccaagcagcgctatctg
gccgcgcagatgctggcgttgatgacgggcgggctgtggcttgatctggcgcgccacgcc
aatgcgatggcggcgcggctggggcaggggctggcacggtcgggggcggaattgctagcc
ccggtgcaggcgaacgaggtctttgcccgcatcgcccccgaggcccatgcagcggcgcgc
gcgcaaggagcggtctatcacctgtggcaggacgtgccgcccggtccgggcgagccggtc
gcgatccggctggtgacaagctgggccacgcgggacgaggacgtcgatcgctttctggac
ctgatcggctag

DBGET integrated database retrieval system