KEGG   Paracoccus yeei: A6J80_04890Help
Entry
A6J80_04890       CDS       T04781                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pye  Paracoccus yeei
Pathway
pye00071  Fatty acid degradation
pye00072  Synthesis and degradation of ketone bodies
pye00280  Valine, leucine and isoleucine degradation
pye00310  Lysine degradation
pye00362  Benzoate degradation
pye00380  Tryptophan metabolism
pye00620  Pyruvate metabolism
pye00630  Glyoxylate and dicarboxylate metabolism
pye00640  Propanoate metabolism
pye00650  Butanoate metabolism
pye00900  Terpenoid backbone biosynthesis
pye01100  Metabolic pathways
pye01110  Biosynthesis of secondary metabolites
pye01120  Microbial metabolism in diverse environments
pye01130  Biosynthesis of antibiotics
pye01200  Carbon metabolism
pye01212  Fatty acid metabolism
pye02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6J80_04890
   00630 Glyoxylate and dicarboxylate metabolism
    A6J80_04890
   00640 Propanoate metabolism
    A6J80_04890
   00650 Butanoate metabolism
    A6J80_04890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6J80_04890
   00072 Synthesis and degradation of ketone bodies
    A6J80_04890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6J80_04890
   00310 Lysine degradation
    A6J80_04890
   00380 Tryptophan metabolism
    A6J80_04890
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6J80_04890
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6J80_04890
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6J80_04890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pye04147]
    A6J80_04890
Enzymes [BR:pye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6J80_04890
Exosome [BR:pye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6J80_04890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARC35810
UniProt: A0A1V0GPT7
Position
496729..497940
Genome map
AA seq 403 aa AA seqDB search
MTDAFIYDTARTPRGKGRPDGSLHEVTSVALSARLLNAVKARNGLEGHAVEDVIWGNVTQ
VKEQGGCLARSAVLASDLDESIPGLSINRFCASGMEAVNLAANQVRAGAGSAYIAGGVEM
MGRVAMGSDGAAIAVDPSLTFPTYFVPQGISADIIATEYGFTREDADKLAVESQRRAAQA
WAEDRFAKSIVPVLDQNGLTILERDEYLRPGTTLEDLARLKPAFKDMGESMPGFDKVALL
KYPHLPAIDHIHHAGNSSGIVDGAAAVLIGDAEFGKAHGLTPRARIRATAKIGTDPTIML
TGPVPVTEKILRDSGMSISDIDLIEVNEAFASVVLRFMQAFQVDPGIVNVNGGAIAMGHP
LGATGAIIIGTLLDELERQDKTVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattcatctatgacaccgcccgtacgccgcgcggcaagggccgtcccgat
ggcagcctgcacgaggtcacctcggttgcgctgtcggcgcggcttctgaacgcggtcaag
gcccgcaacggcctggaaggccacgcggtcgaggacgtgatctggggcaatgtcacccag
gtcaaggaacagggcggctgccttgcccgctcggccgtgctggcctcggacctggacgaa
tcgatccccggcctttcgatcaaccgcttctgcgccagcggcatggaggcggtgaacctg
gccgcgaaccaggtgcgcgccggcgccgggtctgcctatatcgcagggggcgtcgagatg
atgggccgcgtcgccatgggcagcgacggcgccgccatcgcggtcgacccgagcctgacc
tttccgacctacttcgtgccccagggcatcagcgccgacatcatagccaccgaatacggt
ttcacccgcgaggatgcagacaagctggccgtcgaaagccagcgccgcgccgcgcaggct
tgggccgaggaccgctttgcgaaatccatcgtcccggttctggaccagaacgggctgacc
atccttgagcgcgacgaatacctgcgccccggcacgacgctggaggatctggccagactg
aagcccgccttcaaggacatgggcgagtcgatgcccggtttcgacaaggtggcgctgctg
aaatacccgcacctgcccgccatcgaccacatccaccatgccggaaacagctccggcatc
gtggacggggcggcggcggtgctgatcggcgacgcggaattcggcaaggcccacgggctg
acgccccgcgcccgcattcgcgccaccgccaagatcggcaccgacccgaccatcatgctg
accggcccggtccccgtcaccgaaaagatcctgcgcgacagcggcatgtcgatcagcgac
atcgacctcatcgaggtgaacgaggccttcgcctcggtcgtcctgcgcttcatgcaggcg
ttccaggtcgatccgggcatcgtcaacgtgaatggcggcgccattgccatgggccatccg
ctgggcgcgaccggcgccatcatcatcggcacgctgctcgacgaactcgagcggcaggac
aagacagtcggcctggcgacgctctgcatcgcctccggcatgggcgcggccaccatcatc
gagcgggtgtga

DBGET integrated database retrieval system