KEGG   Paracoccus yeei: A6J80_07375Help
Entry
A6J80_07375       CDS       T04781                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pye  Paracoccus yeei
Pathway
pye00450  Selenocompound metabolism
pye00970  Aminoacyl-tRNA biosynthesis
pye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A6J80_07375
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A6J80_07375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pye01007]
    A6J80_07375
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pye03016]
    A6J80_07375
Enzymes [BR:pye01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A6J80_07375
Amino acid related enzymes [BR:pye01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A6J80_07375
Transfer RNA biogenesis [BR:pye03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A6J80_07375
 Prokaryotic type
   Other AARSs
    A6J80_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ARC36219
UniProt: A0A1V0GR88
Position
999008..1000726
Genome map
AA seq 572 aa AA seqDB search
MARHLITSAIPYINGIKHLGNLVGSQLPADLSARYLRARGHEVMFICATDEHGTPAELAA
KKAGKPVAVYCAEMHEIQAEIARNFGLSFDHFGRSSSERNHVLTQHFAGKLDENGWISEV
EESQIYSIDDGRFLPDRYIEGTCPNCGYDKARGDQCENCTKQLDPTDLIEPRSAISGSTN
LEVRRTKHLYLRQRALKDQISQWLDSKTDWPILTTSIARKWLNDGDGLQDRGITRDLDWG
IPVKKGDQPWPGMEGKVFYVWFDAPIEYIAATAEGTDKRGEPDSAWRRWWRLDEGAQDVT
YTQFMGKDNVPFHTLSFPATIIGSGEPWKLVDYIKSFNYLTYDGGQFSTSQGRGVFMDQA
LSILPADYWRWWLLSHAPESGDSEFTWDNFQQSVNKDLADVLGNFVSRITKFCRSKFGET
VPEGGSYGPEEQALIEALTARIRAYETFMDHMEVRKSAAELRAIWVLGNEYLQSAAPWST
VKTDPEKAAMQVRLGLNLIRLYAVLSMPFIPFASDAMLDAMRSGNRDWPDDLAAALRVLL
PGHAFTVPEVLFAKITDEQRDEWQERFKGIRS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcatctcatcacctcggcgatcccctacatcaacgggatcaagcacctcggc
aacctggtcggctcgcagcttccggcggacctctcggcccgctacctgcgcgcgcgcggg
cacgaggtcatgttcatctgcgccaccgacgaacacggcactccggccgaactggcggcc
aagaaggcgggcaagccggtcgcggtctattgcgcggaaatgcatgaaatccaggcggaa
atcgcccggaacttcggcctgtccttcgaccatttcggccgctcctcctcggaacgcaac
cacgtcctgacccagcatttcgccggcaagctcgacgaaaacggctggatctccgaagtc
gaggaaagccagatctattccatcgacgacggccgcttcctgcccgaccgctatatcgag
ggcacctgcccgaactgcggctacgacaaggcccgcggcgaccagtgcgagaactgcacc
aagcagctcgaccccaccgacctgatcgagccgcgcagcgccatctcgggctcgaccaat
ctcgaagtgcgccggaccaagcatctctacctgcgccagcgcgcgctgaaagatcagatt
tcccaatggcttgacagcaagaccgactggccgatcctgaccacctcgatcgcgcggaaa
tggctcaatgacggcgacggcttgcaggaccgcggcatcacccgcgacctcgactggggc
atcccggtcaagaagggcgatcagccctggccggggatggagggcaaggtcttctacgtc
tggttcgacgcccccatcgaatacatcgccgccaccgccgagggcaccgacaagcggggc
gagcccgacagcgcctggcgccgctggtggcgcctggacgagggggcgcaggacgtgacc
tacacccagttcatgggcaaggacaacgtgcccttccacaccctcagcttcccggccacg
atcatcggctcgggcgaaccgtggaagctcgtggactatatcaagtccttcaattacctc
acttatgacggtggccagttcagcacctcgcagggccgcggcgtgttcatggatcaggcg
ctgtcgatcctgccggccgattactggcgctggtggctgctgtcgcacgccccggaatcc
ggcgacagcgaattcacctgggacaacttccagcaatccgtgaacaaggatctggccgac
gttctgggcaatttcgtcagccgcatcaccaagttctgccgcagcaagttcggcgagacc
gtccccgaaggcggcagctacggccccgaggaacaggccctgatcgaggcgctgaccgcc
cgcatccgcgcctatgaaaccttcatggaccatatggaggtccgcaagtccgccgctgaa
ctgcgcgcgatctgggtcttgggcaacgaatacctgcaatccgccgcgccctggtccacg
gtcaagaccgaccccgaaaaggccgcgatgcaggtccggctgggcctgaacctgatccgg
ctttatgccgttctttcaatgcctttcatccccttcgccagcgatgcgatgctggacgcg
atgcgcagcggcaaccgcgactggcccgacgacctggccgccgccctgcgggtcttgctg
cccggccacgcctttacggtccccgaggtcctgttcgccaagatcaccgacgagcaacgc
gacgaatggcaagagcgtttcaagggcatccggagctag

DBGET integrated database retrieval system