KEGG   Paracoccus yeei: A6J80_13270Help
Entry
A6J80_13270       CDS       T04781                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pye  Paracoccus yeei
Pathway
pye00020  Citrate cycle (TCA cycle)
pye00640  Propanoate metabolism
pye00660  C5-Branched dibasic acid metabolism
pye01100  Metabolic pathways
pye01110  Biosynthesis of secondary metabolites
pye01120  Microbial metabolism in diverse environments
pye01130  Biosynthesis of antibiotics
pye01200  Carbon metabolism
Module
pye_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pye_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6J80_13270
   00640 Propanoate metabolism
    A6J80_13270
   00660 C5-Branched dibasic acid metabolism
    A6J80_13270
Enzymes [BR:pye01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A6J80_13270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ARC37220
UniProt: A0A1V0GTV0
Position
complement(2188110..2188994)
Genome map
AA seq 294 aa AA seqDB search
MAVLVNKDTKVICQGLTGSQGTFHTEQAIAYGTQMVGGVTPGKGGSEHLGLPVFNSVHEA
VAKTGANASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMMKVKRALQGSQSRLI
GPNCPGIMTPDECKIGIMPGSIFKRGSVGVVSRSGTLTYEAVKQTSDVGLGQSSAVGIGG
DPIKGMEHIDVLQMFLDDPETESIIMIGEIGGSAEEEAAEFLAEQKRKGKWKPTAGFIAG
RTAPKGRRMGHAGAIVSGGKGDAESKIEAMKSAGIIVADSPAGLGEAVLKAIGR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggccgttctcgtcaacaaagacaccaaagtcatctgccagggcctgaccggctcgcag
gggacgttccacaccgaacaggcgatcgcctacggcacccagatggtcggcggcgtgacg
ccgggcaagggcgggtccgagcacctgggcctgcccgtgttcaactcggtccacgaggcc
gtggcgaaaaccggcgccaacgccagcgtgatctatgtcccgccgcccttcgcggccgac
tcgatcctggaagccatcgacgcggaaatcccgctgatcgtctgcatcaccgaaggcatc
ccggtccttgacatgatgaaggtcaagcgcgccctgcagggcagccagtcgcggctgatc
ggcccgaactgccccggcatcatgacccccgacgaatgcaagatcggcatcatgccaggc
tccatcttcaagcgcggctcggtcggcgtcgtgtcgcgttccggcaccctgacctatgag
gcggtgaagcagacctcggacgtgggcctgggccagtcctcggccgtcggcatcggcggc
gacccgatcaagggcatggagcatatcgacgtgctgcagatgttcctggacgaccccgag
accgagtcgatcatcatgatcggcgagatcggcggctcggccgaggaagaggccgccgag
ttcctggccgagcagaagcgcaagggcaagtggaagccgaccgccggcttcatcgcgggc
cgcaccgcgccgaagggccgccgcatgggccatgccggcgccatcgtctcgggcggcaag
ggcgacgcggaaagcaagatcgaggccatgaaatcggccggaatcatcgtcgccgacagc
ccggcgggtctgggcgaagcggtgctgaaggccatcgggcgctag

DBGET integrated database retrieval system