KEGG   Paracoccus yeei: A6J80_15765Help
Entry
A6J80_15765       CDS       T04781                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pye  Paracoccus yeei
Pathway
pye00670  One carbon pool by folate
pye00790  Folate biosynthesis
pye01100  Metabolic pathways
Module
pye_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A6J80_15765
   00670 One carbon pool by folate
    A6J80_15765
Enzymes [BR:pye01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A6J80_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ARC37631
UniProt: A0A1V0GUX0
Position
complement(2703624..2704100)
Genome map
AA seq 158 aa AA seqDB search
MISLVVARARNGAIGKDNTIPWHIPADMRLFQRETLGSAIIMGRLTWESLPARPLKNRMN
IVVSRDAGLTDHVVPSVRAAIDLATAAGYPRISGIGGEAIFREMLPISDRLLLTEVDLRI
DAADAFFPEFDEAEWREIARRVLPGDGPTATLRELVRR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgctggtcgtcgcccgcgcccggaacggcgccatcggcaaggacaacaccatc
ccctggcatatccccgcggacatgcgcctgttccagcgcgagaccctgggcagcgccatc
atcatgggccggctgacctgggaaagcctgcccgcaaggccgctgaagaaccgcatgaac
atcgtggtgtcgcgcgacgccggcctgacggatcatgtcgtgcccagcgtgcgcgcggcg
atcgatctggcgaccgccgctggctatccccgcatttcgggcatcggcggcgaggcgatc
tttcgcgagatgctgccgatcagcgaccggctgctgctgaccgaggtcgacctgcgcatc
gacgccgcggacgccttcttccccgagttcgacgaagccgaatggcgcgagatcgcccgc
cgggtgctgccgggtgacggcccgaccgccaccctgcgtgaactcgtccggcgctaa

DBGET integrated database retrieval system