KEGG   Paracoccus yeei: A6J80_18340Help
Entry
A6J80_18340       CDS       T04781                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pye  Paracoccus yeei
Pathway
pye00860  Porphyrin and chlorophyll metabolism
pye01100  Metabolic pathways
Module
pye_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pye00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6J80_18340
Enzymes [BR:pye01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     A6J80_18340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARC38632
UniProt: A0A1V0GXU1
Position
complement(3204354..3204890)
Genome map
AA seq 178 aa AA seqDB search
MDMEEARLLIARHAPLARPGLAGRRDVPADCSDRAALGWLAGQLRGMPLLSSPALRCRQT
CEAMGLEARAVPALWEQDLGAWETEGLPDLGPLSPADLARHRPPGGESFLDMAARVQPAL
AEILGTVGIVAHAGTVRAALALAVGPAALSFAVAPLSLTILSRSAGGWAVEAVNRVAP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggacatggaagaggcccgactgctgatcgcgcggcacgcgccgctggccaggccgggg
ctggccgggcgccgcgacgtgccggccgattgcagcgaccgcgccgcgctgggctggctg
gctggccagttgcgggggatgccgctgctgtccagtcccgcgctgcgctgccgccagacc
tgcgaggcgatggggctggaggcgcgcgccgtgcccgccctgtgggagcaggacctgggc
gcctgggagacggagggcctgcccgacctggggcccctttcgcccgccgatctggcgcgc
caccgcccgcccgggggcgaaagctttctggacatggccgcccgggtgcagcccgcgctg
gccgagatcctgggcaccgtcgggatcgtcgcccatgcgggcacggtccgggcggcgctg
gcgctggccgtgggacccgccgctctgtcatttgccgtcgcgccgctgtcgctgaccatc
ctgagccgctcggccgggggatgggcggtcgaggcggtcaaccgcgtcgcgccatga

DBGET integrated database retrieval system