KEGG   Paracoccus yeei: A6J80_21705Help
Entry
A6J80_21705       CDS       T04781                                 

Definition
(GenBank) hypothetical protein
  KO
K03201  type IV secretion system protein VirB6
Organism
pye  Paracoccus yeei
Pathway
pye03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pye00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A6J80_21705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pye02044]
    A6J80_21705
Secretion system [BR:pye02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   A6J80_21705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL DUF4431
Motif
Other DBs
NCBI-ProteinID: ARC38907
UniProt: A0A1V0GYI6
Position
unnamed4:complement(160707..161753)
Genome map
AA seq 348 aa AA seqDB search
MGIVTDILTSLDNSIRVTGELFFENTAHAMTPVLSIMMTLMLSLVAMNMALGVWRMSARD
ATQLATRILMVYLFALSWRNFGSFYEALSSASGNLALSFFDRAGDTGRESTYAAMDLFAL
QMGDTADGVLRGMGSIARGFLGATTYLMLAVLMAAYVLIVGFAKIMIAVLLGIAPLAIIM
TLFDKTKSLFEAWLSSFVGYLMYPIAAAAVVATVVTLANQQAVAQEDVSSVDQILGFLVI
AIVGIGALWEIRTAATNITGQIHLASFAPQALRMGNRAAGLGGRIGQAGIAGVASAAGMA
TAGAALAHPAAAVAGALGTLPTAMNQRSAREAGSALRQKLGAISMLRR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgtcaccgacatcctgacctcgctcgacaacagcatccgtgtcacgggcgag
ctattcttcgagaacaccgcgcatgcaatgacgcccgtgctgtcgatcatgatgacgctg
atgctgtcgctggtggccatgaacatggcacttggggtctggcggatgagcgcgcgggat
gcgacgcagctcgcaacccggatcctgatggtttatctgttcgcgctctcctggcggaac
ttcggcagtttctacgaggcactgtcctcggccagcggcaacctcgccctgtcgttcttt
gaccgtgccggcgataccgggcgcgaaagcacctatgccgccatggacctgttcgccttg
caaatgggcgacacggccgatggagtgctgcgtggcatgggctccatcgcccgcggtttc
cttggcgcaacgacctatctgatgcttgccgttctgatggcggcctatgtcctaatcgtg
ggctttgccaagatcatgatcgcggtcctgctgggcattgcaccgcttgccatcatcatg
acgctgttcgacaagaccaagagcctgttcgaggcgtggctgtcgtcctttgtcggctac
ctgatgtatccgatcgcagcggcggccgtggtggcgacggtggtaacactcgccaaccag
caggcggtcgcacaggaggacgtcagcagcgtcgaccagatccttgggttcctggtcatc
gccatcgtcggcatcggagcgctgtgggagatccgcaccgccgccacgaacatcactggt
cagattcatcttgcatcgttcgcgccacaggcgctgcgaatgggcaaccgcgcagccggc
ttgggagggcggatcgggcaggcagggatcgcaggcgtcgccagcgcggcgggtatggcc
accgcgggcgcggcactggcgcatcctgccgcggcggtggctggcgcccttggcaccctg
cccactgccatgaaccagcgcagcgcgcgtgaagccggcagcgcgctgcggcaaaagctt
ggcgcgatcagcatgctgcgtcgctga

DBGET integrated database retrieval system