KEGG   Paenibacillus yonginensis: AWM70_00150Help
Entry
AWM70_00150       CDS       T04810                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pyg  Paenibacillus yonginensis
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AWM70_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANS73190
UniProt: A0A1B1MVI1
Position
25297..26295
Genome map
AA seq 332 aa AA seqDB search
MDTTLLVLGVVIILALAFDFINGFHDTANSIATSVSTRALTPRRAILLAASMNFLGAILF
TGVAKTIGGKIADPTTMDNGLEVIIATLLAAIIWNLVTWFFGIPSSSSHALIGALVGAVF
VGAGSDHVKWSGFREILEGLLLSPIIAFIVGYIVMTILKYIFARRSPHTVNKGFRMLQIL
TAALQSFTHGTNDAQKAMGIITFALVTSGELSDLTVPLWVKISAALSMALGTSVGGWKII
KTMGTKIFKIEPINGFAADISAASVIFSATLLHLPVSTTHAITPAILGVGAAKRFSAVRW
SLAGRIVITWFITIPISAVLAGLIYKLLFGWS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacaactttgctcgtattaggcgtcgtcatcatccttgcgcttgcctttgacttt
atcaacgggttccacgacacggcgaactcgatcgccacttccgtctcaacccgggcctta
acgccgcgcagagcgattctgctggccgcttcgatgaacttccttggcgcgatcctgttc
acaggtgtagcgaagacgatcgggggcaaaatcgccgatccaaccacgatggacaacggt
cttgaggtcattatcgccacgctgctggcagcgattatctggaacctggtgacctggttc
ttcggcattccgtcgtcttcctcccatgcgctgatcggtgcgctggtgggtgccgtgttt
gttggagccggttcggaccatgtcaaatggtccggcttccgcgaaattctggaaggtttg
ctgctgtcgccgattattgcctttattgttggttatatcgttatgacgatactcaaatac
atttttgcgagaagaagtccccatacggtcaacaaaggtttccgtatgctgcaaattctg
acagctgcgctgcagtccttcacccatggcaccaatgatgcccagaaggcgatggggatc
attacctttgctttagtgacatccggcgagctttccgatttaaccgtccccttgtgggta
aaaatatcggcggctttgtccatggcgctcggcacctcggtcggcggatggaagatcatc
aaaacgatgggcaccaaaatcttcaaaatcgagccgatcaacggttttgcggctgatatt
tcggcggcctccgttattttctcggctacgctgctgcacctgccggtcagcaccacgcat
gcgattaccccggcgatcctcggcgtaggcgctgcgaaacgattctcggccgtgcgctgg
tcgcttgccggacgaatcgtaatcacctggttcatcaccattccgatttccgccgttttg
gccggtctgatttacaagctgctgttcggctggtcttga

DBGET integrated database retrieval system