KEGG   Paenibacillus yonginensis: AWM70_01850Help
Entry
AWM70_01850       CDS       T04810                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AWM70_01850
Enzymes [BR:pyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AWM70_01850
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AWM70_01850
    1.1.1.-  
     AWM70_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: ANS73480
UniProt: A0A1B1MWB8
Position
complement(424673..425725)
Genome map
AA seq 350 aa AA seqDB search
MKALRWHGVKDLRIETIEEPVTAKGQVKIKIEWCGICGSDLHEYAAGPIFISQGAPHPLT
HEEAPVVMGHEFSGQVVEVGEGVTRFKTGDRVVVEPIFNCGECAACRQGKYNLCEQMGFL
GLAGGGGGFSEYVATEEHRVHKIPESVSFEQGALVEPSAVALYAVRQSQFKVGDRAVVFG
AGPIGLLVIEALKASGASSIYAVELSQERRNKAEELGAIGINPAEQDVIAEICRLSDGGA
DVAFEVTGVPVVLQQAIQSTRIGGQIMIVSIFEKEAAIHPNQIVMQERNIAGIIGYRDVF
PAVISLMEQGYFSAEKLVTKRIALDDAVEQGFEALLKEKNQVKILVTPNR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacgttggcacggtgttaaagacctgagaatcgaaactatcgaggaaccg
gtgacagccaaagggcaagtcaaaattaaaatcgaatggtgcgggatctgcggcagtgat
ctgcacgaatatgcggcaggccctatttttatatcccaaggtgctccacatcccttaacc
catgaagaagctcctgttgttatgggccatgaattttccggacaggtggtcgaggttgga
gaaggcgtgacccgcttcaaaaccggcgaccgggtcgtagtagaacctatctttaattgc
ggggagtgtgcggcttgccggcaaggcaaatataatttgtgcgaacagatgggcttcctc
ggtctggctggaggcggcggcggtttctccgaatacgttgcgaccgaagagcaccgtgtg
cacaaaattccggaaagcgtttcctttgagcagggggcattggttgaaccctctgcggta
gccctgtatgccgtacgccaaagccaatttaaggtcggcgaccgagcagtggtatttgga
gccggtcctatcggactgctggtcatcgaagcgcttaaagcatccggtgcctcgtccatt
tatgccgtggagttgtcgcaggaacgccggaacaaagccgaagagcttggagccattggc
atcaacccggccgagcaggatgtgattgctgaaatttgccgcctgtcggacggcggagcc
gacgtggcttttgaagtgaccggcgttccagtcgtgcttcagcaggcgatccaatctacg
cggattggcggccagatcatgatcgtaagcatttttgaaaaagaagcggctatccacccg
aatcaaatcgtcatgcaggaacggaatattgcaggcatcatcggataccgggatgttttc
cctgccgttatcagcctcatggagcagggatatttctccgccgagaagcttgtcaccaaa
cgtattgctttggatgacgccgtcgagcaaggctttgaagcgctgcttaaagagaagaac
caggtgaagattctggtcactcccaaccgctaa

DBGET integrated database retrieval system