KEGG   Paenibacillus yonginensis: AWM70_10370Help
Entry
AWM70_10370       CDS       T04810                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg00450  Selenocompound metabolism
pyg00970  Aminoacyl-tRNA biosynthesis
pyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AWM70_10370
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AWM70_10370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pyg01007]
    AWM70_10370
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pyg03016]
    AWM70_10370
Enzymes [BR:pyg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AWM70_10370
Amino acid related enzymes [BR:pyg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AWM70_10370
Transfer RNA biogenesis [BR:pyg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AWM70_10370
 Prokaryotic type
   Other AARSs
    AWM70_10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: ANS74953
UniProt: A0A1B1N0J7
Position
complement(2238650..2240665)
Genome map
AA seq 671 aa AA seqDB search
MATDNKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGFDVRYLTGTDEHGQKIE
RKAQEKGLTPQQFVDNIVVGIKELWKKLDISNDDFIRTTDAKHKQIVQDIFDRLLQQGDI
YKGEYEGWYSIPDETYYTETQLVEPVKNDKGEIIGGKSPDSGHPVELVKEESYFFRMSKY
ADRLLQFYEENPGFIQPESRKNEMINNFIKPGLEDLAVSRTTFEWGVKVKGDPKHVVYVW
IDALSNYITALGYGTDNPELYNRYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVF
AHGWLLMKGGKMSKSKGNVVDPNTLIDRYGLDATRYYLLREVPFGADGSFTPESFVERVN
SDLANDLGNLLNRTVAMVGKYFDGVTPAYIPNATEFDAALTAAAQKTVEKVEEVMENMEF
SVALASIGQFISRTNKYIDETQPWVMAKEGDKQEQLGSVMVHLMESLRIASILLQPFLTQ
APAKIWSQLGISPGELTSWESAKSFGLIPAGTRLGQGEPIFPRLDAEQEVAYIAESMTGG
VPAEEAKAAGGGPQSTAEEAVELKEEIGIEDFAKVELRVAQVVAAEAVKKADKLLKLQLD
LGFEQRQVVSGIAKFYSPEELVGRKVIVVVNLKPVKLRGELSQGMILAASHGDQLTLATV
PDNMPNGAVVK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacagacaacaaaactttttacattacaacacccatttattatccgagcgacaag
ctgcatatcggtcatgcttatacgacggtagccggtgacgctatggcccgttacaaacgc
ctgcgcggttttgacgtgcgttatttgacggggaccgatgagcatggtcagaagatcgag
cggaaagcccaggagaaaggcctgaccccgcagcagtttgtagacaacattgtggtcggc
attaaagaactttggaagaaactcgacatttccaacgatgattttatccgcacaacggat
gcgaaacacaaacagattgttcaggatatttttgaccggctgcttcagcagggggatatc
tacaaaggggaatatgaaggctggtacagcattcctgatgaaacgtattatacggaaacg
cagctggtcgagccggtcaaaaatgacaagggcgaaatcatcggcgggaaatcgccggac
agcggccacccggttgagctggtaaaagaagaatcttatttcttccggatgagcaaatat
gctgatcgtctgttacagttttacgaggagaatccaggtttcattcagccggaatcccgt
aagaacgaaatgatcaacaactttatcaaaccgggcctggaagacttggccgtctcccgg
actacgtttgaatggggcgtaaaggtgaaaggcgaccctaaacatgtggtttacgtttgg
attgatgcgttgtcgaactatattacagctcttggctacggcacggataatcctgagctt
tataatcgttattggccggcggatgtccatctggtcgggaaagagattgtccggttccat
acgatttattggccgattatgctgatggctttagggctgccgcttccgaaaaaggtattt
gcccatggctggctgctcatgaagggcggcaaaatgtccaaatccaaaggcaacgtcgta
gatccgaacaccttgattgaccgttacggcctggatgcgacccgctattatctgctgcgc
gaggtcccgtttggcgcggacggcagctttacgccggagagcttcgtagagcgggttaac
tccgatctggccaacgatcttggcaatctgctgaaccggactgtagcgatggtcggcaaa
tattttgacggcgtaaccccggcttatattccgaatgctaccgagttcgacgcagctttg
accgcagcggcacagaagacggtagaaaaggtcgaagaggttatggagaacatggagttc
tcggtagcgcttgcttccatcggccagtttatcagccgtacgaacaaatatatcgatgaa
acccagccatgggtaatggcgaaggagggcgacaaacaagagcagcttggctccgttatg
gtgcatttgatggaatcgctgcggattgcttcgatcctgcttcagccgttcctcacgcag
gcaccggccaaaatctggagccaattgggcatttcgcctggggaattgacctcctgggaa
agcgcaaaaagttttggcctgattccggcgggcacgcgtttaggccaaggggaacccatc
ttcccgcggcttgatgccgagcaggaagtggcttatatcgccgagtcgatgaccggcgga
gtgcctgcggaagaagcgaaggcagctggcggaggccctcagtctactgccgaagaggcc
gtagagctcaaagaagaaatcggcattgaagatttcgctaaggtggagctgcgggtcgca
caggttgtggccgcagaggcggtgaagaaagccgataagctgctgaagctgcagcttgac
ttaggttttgagcagcgccaggtggtgtccggcatcgctaaattctacagccccgaggaa
ctggtaggacgcaaggtgatcgtagtggttaacctgaagccggtgaagctgcgcggtgag
ctgtcccaaggcatgattctggccgcttcccatggcgatcagctgacgctggccactgtt
cccgacaacatgcctaacggcgctgttgtgaaataa

DBGET integrated database retrieval system