KEGG   Paenibacillus yonginensis: AWM70_10430Help
Entry
AWM70_10430       CDS       T04810                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg00010  Glycolysis / Gluconeogenesis
pyg00071  Fatty acid degradation
pyg00350  Tyrosine metabolism
pyg00620  Pyruvate metabolism
pyg00625  Chloroalkane and chloroalkene degradation
pyg00626  Naphthalene degradation
pyg00650  Butanoate metabolism
pyg01100  Metabolic pathways
pyg01110  Biosynthesis of secondary metabolites
pyg01120  Microbial metabolism in diverse environments
pyg01130  Biosynthesis of antibiotics
pyg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWM70_10430
   00620 Pyruvate metabolism
    AWM70_10430
   00650 Butanoate metabolism
    AWM70_10430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWM70_10430
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AWM70_10430
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AWM70_10430
   00626 Naphthalene degradation
    AWM70_10430
Enzymes [BR:pyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AWM70_10430
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AWM70_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ANS74964
UniProt: A0A1B1N0K3
Position
complement(2256314..2258938)
Genome map
AA seq 874 aa AA seqDB search
MAVKNEAASNVKQAVQPAQEYIQGLIDKAKKASEAFMSMDQQQIDDIVQAMALAGLDKHM
YLAKKAVEETGRGVYEDKIIKNMFATEYIWNSIKYGKTVGVIEDNPYESFQKIAEPVGII
MGITPVTNPTSTTIFKSLIAIKTRNPIIFGFHPSAQECSREAAKILLEAAVKHGAPADCI
QWIEQPSMDRTNALMNHPDVACILATGGSAMVKAAYSCGKPALGVGPGNVPCFIEKSADL
DQAVNDLILSKTFDNGMICASEQAVIIEEPIFDQVKKKMIANGCYFVNKEEAAKLTAGAI
VAEKCAVNPAIVGQPAVKIAEMCGIQVPAGTKILVAEIDGVGPKFPLSAEKLSPVLACYK
VKTAEQGIDLAEQVVHFGGMGHSSVIHSNNDEIIQKFSDRLPTCRILVNQPSSQGGIGDI
YNTNLPSLTLGCGSYGRNSTSSNVTAVNLINVKRVNHRTVNMQWFKVPSKIYFEKGATQY
LAKMPDINRVMIVTDPMMVKLGYVERLEHYLRQRQTPVAIEVFSDVEPDPSTTTVARGTE
MMAKFQPDCIIALGGGSPMDAAKGMWLFYEYPDTDFHNLKQKFMDIRKRTYKYPSLGQKA
KFVAIPTTSGTGSEVTPFAVITNKEVGNTKYPLADYELTPDVAIIDPEFVYSLPKVAVAD
TGMDVLTHGIEAYVSVMANDYTDGLAIKAIQLVFQYLEKSALTGDKLAREKMHNASTLAG
MAFANAFLGINHSLAHKWGGQYHTAHGRTNAILLPHVIRYNAKKPTKFAAWPKYTNFVAD
QRYAEIARILGLPARTTEEGVKSLINAIRDLNKKLGIPESFQALGFDPKDFESNVDYLAD
RAFEDQCTTANPKLPLVTELAEVYRDAFYGRFEE
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaaaaatgaagcagcttcaaatgtaaagcaggccgtacagcctgcacaggag
tacatccaaggtttgatcgacaaagcgaaaaaagcttcagaggctttcatgagcatggat
cagcagcaaatcgacgacattgtgcaggcgatggctctggccgggctcgacaaacacatg
tacctcgccaagaaagccgttgaagaaacgggccgcggggtatacgaggacaaaattatt
aaaaacatgttcgctaccgaatacatctggaacagcatcaaatatggcaagacggtcggc
gtgattgaagacaatccttacgaaagcttccagaagatcgctgaaccggtcggcattatt
atggggattacgccggtgacgaatccgacttccacgacgatcttcaaatctttgatcgcc
attaagacacgcaacccgattatcttcggcttccacccttccgcacaggaatgcagccgc
gaagccgctaaaattctgctggaagccgctgtgaaacacggcgctcccgccgattgcatc
caatggatcgaacagccttccatggaccgaaccaacgctttgatgaatcatcctgatgta
gcctgcattctcgccaccggcggttccgccatggtgaaagcagcttacagctgcggcaaa
ccggctctcggcgtaggtcccggcaacgtgccttgcttcattgagaaaagcgctgatttg
gatcaagcggttaatgatttgatcctgtccaaaacgttcgacaacggcatgatctgtgct
tccgaacaagcggttattattgaagagcctatttttgaccaagtgaagaaaaaaatgatc
gccaacggctgctatttcgtcaacaaggaagaagccgccaagctgacggccggagctatt
gtcgccgaaaaatgcgccgttaatccggccatcgtcggacagccagccgttaaaattgcg
gaaatgtgcggcattcaggtgccggccggaaccaaaatccttgtcgccgaaattgacggc
gtaggtcctaaattcccgctgtctgcggagaagctcagccctgtactggcctgctacaaa
gtaaaaaccgctgaacaaggcatcgaccttgcggaacaggttgtacacttcggcggcatg
ggacattcgtcggttattcattcgaacaacgatgaaatcatccagaaattttcggaccgt
ctgccaacctgccggatcctggtgaaccagccttcttcgcagggcggcatcggcgacatc
tacaacacgaacctgccgtcgctgacgctgggctgcggctcttacggacgcaactccact
tcttcgaacgtgaccgccgtcaacctgattaacgtgaaaagggtgaaccatcgtaccgtg
aatatgcagtggtttaaagtaccttccaaaatctattttgaaaaaggcgcaacccagtac
ctggccaaaatgccggacattaaccgtgtcatgatcgttaccgacccgatgatggtgaag
ctgggatatgtggaaagattggagcattacctccgtcagcgccaaacgcctgtagcgatc
gaagtgttctccgacgttgaaccggatccatcgactacgaccgttgcccgcggtactgaa
atgatggcgaaattccagccggactgcatcatcgctctaggcggcggttcgccgatggat
gccgccaaaggcatgtggctgttctatgaatatccggacaccgatttccacaacctgaaa
cagaaattcatggatatccgcaaacggacctacaaataccctagcttgggtcaaaaagca
aaattcgtagcgatcccgacaacatccggtacaggttccgaagttacgccgtttgcagtt
attactaataaagaagtcggcaacaccaaatatcctttggccgattacgagctgacgccg
gacgttgcgatcatcgaccctgaattcgtctacagcctgcctaaagtagccgttgccgat
accggcatggacgtgctgactcatggtatcgaagcttatgtatccgttatggcaaacgat
tatacggacggcctggcgattaaagcgattcagctggtgttccaatatctcgagaaatcg
gctttgaccggcgacaaactcgcccgcgagaaaatgcacaacgcttcgactctggccggt
atggcttttgcgaatgcgttcctgggcatcaaccacagcttggcgcataaatggggcggt
caatatcataccgctcacggacgtaccaacgcgatcctgctgccgcacgtcatccgctat
aacgcgaagaaacctacgaaatttgcggcttggcctaagtacactaacttcgtagccgac
cagcgttatgccgaaatcgcccgcatcctgggactgcccgcacgcaccacagaagaaggc
gtgaagagcctgatcaacgcgatccgcgacctgaacaaaaagctgggcattccggagtcg
ttccaggcgctcggatttgatccaaaagattttgaatcgaatgtagattatcttgcagac
cgcgccttcgaggatcaatgcacaaccgccaatcctaagctgccgctggtcaccgagctt
gccgaggtatacagagacgccttctacggacgtttcgaagagtaa

DBGET integrated database retrieval system