KEGG   Paenibacillus yonginensis: AWM70_16580Help
Entry
AWM70_16580       CDS       T04810                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AWM70_16580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pyg03011]
    AWM70_16580
Ribosome [BR:pyg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AWM70_16580
  Bacteria
    AWM70_16580
  Archaea
    AWM70_16580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANS75995
UniProt: A0A1B1N3L9
Position
complement(3621345..3621677)
Genome map
AA seq 110 aa AA seqDB search
MEARAHANMIRIAPRKAQLVVDLIRGKKVGEAIAILRHTPKAASPIVEKLLNSAIANAEH
NYSMDVNKLVVTQAYVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
ttggaagcaagagcacatgctaatatgatccgcatcgctccgcgtaaagctcaactcgtt
gttgatttgattcgcggtaagaaagtgggcgaggctatcgcaatccttcgccatactcct
aaagcagcttctccgatcgtagaaaaattgctgaactcggctatcgcaaacgctgagcac
aactattctatggatgttaataaattggtggttacgcaggcttacgtaaaccaaggacca
acgatgaaacgtttccgtccgcgggctatgggtcgtgcaagccgtattaacaaacgcacc
agccacattacattggtggtatctgaaaaataa

DBGET integrated database retrieval system