KEGG   Paenibacillus yonginensis: AWM70_20140Help
Entry
AWM70_20140       CDS       T04810                                 

Definition
(GenBank) transferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
pyg  Paenibacillus yonginensis
Pathway
pyg00520  Amino sugar and nucleotide sugar metabolism
pyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AWM70_20140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pyg01005]
    AWM70_20140
Enzymes [BR:pyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     AWM70_20140
Lipopolysaccharide biosynthesis proteins [BR:pyg01005]
 Unusual sugar
  AWM70_20140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 BacteriocIIc_cy
Motif
Other DBs
NCBI-ProteinID: ANS76602
UniProt: A0A1B1N5B3
Position
4421657..4422241
Genome map
AA seq 194 aa AA seqDB search
MGDYFAHPTAVIDDGAEIGEGTKIWHYSHISARAVIGRGCSLGQNVYVADRVMIGSGVKI
QNNVSVYEGVELEDDVFCGPSMVFTNVRTPRSAFPRNTSKDYHRTLVKKGAAIGANATVV
CGVTIGEWAFVAAGAVVTRDVPAYACVAGVPARRIGWTCQCGGRLKFELAAACCPDCGRQ
YVREDGCIVKLREE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggggattattttgcgcatccgacagcggtgatcgatgacggcgccgaaatcggcgaa
gggacaaagatatggcattacagccacatctccgcccgggcggtgatcggacgaggctgc
agcctggggcaaaacgtgtatgtggcggatcgggttatgatcggcagcggcgtcaaaatt
cagaataatgtatccgtctatgaaggagtagagctggaggacgacgtgttctgcggtccc
agcatggtatttacgaatgtgcggacaccgcggtctgcttttccccggaacacaagcaag
gactatcaccggacactcgtcaaaaaaggggctgccatcggggctaacgccaccgtggtg
tgcggcgtcacaatcggcgaatgggcgtttgtcgccgccggagcggtcgtgacccgcgat
gttccggcttacgcctgcgtcgccggtgttccggccaggcggatcggatggacctgccaa
tgtggaggccggttaaagttcgagcttgcggccgcgtgctgtccggactgcggaagacag
tacgtaagggaagacggctgtatcgtcaaattaagggaggaataa

DBGET integrated database retrieval system