KEGG   Pseudomonas yamanorum: AK972_0751Help
Entry
AK972_0751        CDS       T05821                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00020  Citrate cycle (TCA cycle)
pym00620  Pyruvate metabolism
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01120  Microbial metabolism in diverse environments
pym01130  Biosynthesis of antibiotics
pym01200  Carbon metabolism
Module
pym_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pym_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AK972_0751
   00620 Pyruvate metabolism
    AK972_0751
Enzymes [BR:pym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AK972_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 DUF4347 Cue1_U7BR
Motif
Other DBs
NCBI-ProteinID: AMW81551
UniProt: A0A143GBH2
Position
complement(796907..798415)
Genome map
AA seq 502 aa AA seqDB search
MAHNEAVDVVLVGAGIMSATLAVLLKELDPGLKLEVVELMDSGAAESSNPWNNAGTGHAG
LCELNYTPQAADGSIDIKKAVHINTQFEVSKQFWAYLTKKGTFGSSKSFISPVPHLSFVQ
GEKGVSFLKKRFETLSQHHAFSDMHYTEDRSEMAEWMPLMMPGRPLDEKIAATRVMNGTD
VNFGALTNQLLSHLTSAPDAQVKYSKRVTGLKRNGAGWTVSIKDVNSGNSRDVDAKFVFL
GAGGAALPLLQASGIEESKGFGGFPVSGQWLRCDNPEVVKHHQAKVYSQAAVGSPPMSVP
HLDTRVVDGKKSLLFGPYAGFTTKFLKHGSFLDLPLSIRAGNIGPMLAVARDNMDLTKYL
VSEVRQSMEQRLESLRRFYPEAKAEDWRLEVAGQRVQIIKKDPKKGGVLQFGTELVAAKD
GSLAALLGASPGASVTVSIMLELIERCFPTKAAGEWAAKLHEIFPAREKVLETDAELYRK
INTQNNISLELVEQSSETESYA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacgaagcagtcgacgtagtactggtaggtgcgggcatcatgagtgccacc
ctcgccgtactgctcaaagagctcgaccccggcctcaagctggaagtcgttgagctgatg
gattcgggtgccgcggaaagttccaacccgtggaacaacgccggtaccggccacgccggg
ctgtgtgagctgaactacacaccgcaggccgctgacggctccatcgacatcaagaaagct
gtgcacatcaacacccaattcgaggtgtcgaagcagttctgggcttacttgaccaagaaa
ggcacctttggctcgtccaagtcctttatcagccccgtgccgcacctgagtttcgtgcag
ggcgagaaaggcgtgtcgttcctcaagaagcgttttgaaaccctcagccagcaccacgcg
ttctcggacatgcactacaccgaagaccgcagcgaaatggccgagtggatgccgctgatg
atgcccggccgccccctggacgaaaaaatcgctgccacccgcgtgatgaacggcaccgac
gtcaacttcggcgccctgaccaaccaactgctctcgcacctgaccagcgcaccggatgcc
caggtcaagtacagcaagcgcgtcaccggcctcaagcgcaacggcgccggctggaccgtg
agcatcaaggacgtcaacagcggcaactcccgtgatgtggacgccaagttcgtgttcctc
ggcgccggtggcgcggccctgccgctgctgcaagcctcgggcatcgaagaaagcaaaggc
ttcggcggtttccccgtaagcggccagtggctgcgttgcgacaacccggaagtggtcaag
caccaccaggccaaggtctacagccaggcggccgtgggttcgccacccatgtcggtgccg
cacctggacacccgtgtggtcgatggcaagaagtccctgctgttcgggccatacgccggc
ttcaccaccaagttcctcaaacacggttcgttccttgacctgcccctgtcgattcgcgcc
ggtaacatcggcccgatgctggccgtggcccgggacaacatggacctgaccaagtacctg
gtcagcgaagtgcgccagtccatggaacagcgcctggaatccctgcgtcgcttctaccct
gaggcgaaagccgaagactggcgcctggaagtggccggccaacgggtgcagatcatcaag
aaagacccgaagaaaggcggcgtgctgcaattcggtaccgaactggttgcggccaaggac
ggctcgttggccgccctgctgggcgcatctccgggcgcttcggtgacggtgtcgatcatg
ctggaactgatcgaacgctgcttcccgaccaaagcggccggtgaatgggctgccaagctg
cacgagatcttcccggctcgggaaaaggtccttgagaccgatgccgagctgtatcgcaag
atcaacacgcagaacaacatcagcctggaactggttgagcagagcagcgagaccgaaagc
tacgcttga

DBGET integrated database retrieval system