KEGG   Pseudomonas yamanorum: AK972_0826Help
Entry
AK972_0826        CDS       T05821                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00051  Fructose and mannose metabolism
pym00520  Amino sugar and nucleotide sugar metabolism
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01130  Biosynthesis of antibiotics
pym02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AK972_0826
   00520 Amino sugar and nucleotide sugar metabolism
    AK972_0826
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    AK972_0826
Enzymes [BR:pym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AK972_0826
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AK972_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AMW81626
UniProt: A0A143GCR8
Position
complement(880366..881817)
Genome map
AA seq 483 aa AA seqDB search
MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEHTLFQQTLERLVFDGMDAPIVVCNKDHR
FIVNEQLAARKLETQRILMEPFGRNTAPAVALTAMMLVNEGRDELMLVLPADHVLDDQKA
LQRALALATVAAERGEMVLFGVPATRPETGYGYIKSTNDSLLPEGVSRVQQFVEKPDEKR
ATEFVKSGGYFWNSGMFLFRASRFLEELKKHDPDIYDTCVLTLERSNHTADTIDIDESTF
ACCPDNSIDYAVMEKTQLACVVPLTAGWSDVGCWASLWDVNEKDANGNVSKGDVVIQDSK
NCMIHGNGKLVSVIGLENIVVVETKDAMMIAHKDKVQGVKQMVNTLNEQGRSETQNHCEV
YRPWGSYDSVDMGGRFQVKHISVKPGACLSLQMHHHRAEHWIVVSGTAEVTCDENVFLLT
ENQSTYIPIASVHRLRNPGKIPLEIIEVQSGSYLGEDDIERFEDIYGRSTPIERGVSVKT
IAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcccagtaatcctttccggtggtagcggctcacgtctttggccgctttcgcgtaaa
cagtttcccaagcagttcctggccctgaccggcgagcacaccctgttccagcaaaccctg
gagcgcctggtgttcgacggcatggacgcacccatcgtggtctgcaacaaggaccatcgc
tttatcgtcaacgagcaactggctgcccgcaaactggaaacccagcgcatcctgatggaa
ccgttcggccgcaacaccgcgccggctgtggccctgacggcgatgatgctggtcaacgaa
ggccgtgacgagttgatgctggtgctgccggccgaccacgtgctggacgaccagaaagcc
ctgcaacgcgccctggccctggccactgtggcagccgagcgtggcgaaatggtgctgttc
ggcgtgccggccacccgtccggaaaccggctacggctacatcaagtcgaccaacgattcg
ctgctgcccgaaggcgtcagccgcgtgcaacagttcgttgaaaaacctgatgaaaaacgc
gccaccgaattcgtcaaaagcggtggttatttctggaacagcggcatgttcctgttccgc
gccagccgcttcctggaagagctgaaaaagcacgacccggacatctacgacacctgcgtg
ctgaccctggagcgcagcaaccacaccgccgacaccatcgacatcgacgagtccaccttc
gcttgctgcccggacaattccatcgactacgccgtgatggaaaaaacccagttggcctgc
gtggtgccattgaccgccggctggagcgacgtgggttgctgggcatcgctgtgggacgtg
aatgaaaaagacgccaacggcaacgtcagcaagggcgatgtggtgatccaggacagcaag
aactgcatgatccacggcaacggcaagctggtgtcggtgatcggcctggaaaacattgtg
gtggtggaaaccaaggacgcgatgatgattgcccacaaggacaaggtccagggcgtcaag
cagatggtcaacaccctcaatgagcagggccgcagcgaaacccagaaccactgcgaggtg
taccgtccgtggggttcgtacgactcggtggacatgggcggccgcttccaggtcaagcac
atctcggtcaagccgggcgcctgcctgtcgttgcagatgcaccaccaccgcgccgaacac
tggatcgtggtcagcggcaccgccgaagtcacctgtgacgagaacgtgttcctgctcacc
gaaaaccagtccacctacatcccgattgcctcggtgcaccgcttgcgcaacccgggcaag
atcccattggagatcattgaggtgcagtccggcagctacctgggtgaagacgatatcgag
cgttttgaagatatctacggtcggtctacgccaatcgagcgtggcgtgtcggtgaaaacc
atcgcgcagtaa

DBGET integrated database retrieval system