KEGG   Pseudomonas yamanorum: AK972_0968Help
Entry
AK972_0968        CDS       T05821                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00450  Selenocompound metabolism
pym00970  Aminoacyl-tRNA biosynthesis
pym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AK972_0968
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AK972_0968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pym01007]
    AK972_0968
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pym03016]
    AK972_0968
Enzymes [BR:pym01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AK972_0968
Amino acid related enzymes [BR:pym01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AK972_0968
Transfer RNA biogenesis [BR:pym03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AK972_0968
 Prokaryotic type
   Other AARSs
    AK972_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1f tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AMW81768
UniProt: A0A143GC96
Position
complement(1047861..1049840)
Genome map
AA seq 659 aa AA seqDB search
MLEYIQTDMWVRFQKHRGNQCIYVCADDAHGSAIMLRAEKEGITPEQLIANVQAEHSADF
AEFLVDFDNFHSTHSEENRELSSQIYLRLKDAGHIATRSITQYFDPEKKMFLADRFIKGT
CPKCGTEDQYGDNCEKCGATYAPTDLKDPKSAISGATPVLKDSQHFFFKLPDFQQMLQTW
TRSGTLQDAVANKIAEWLDAGLQQWDISRDAPYFGFEIPGEPGKYFYVWLDAPIGYMASF
KNLCDRKPELDFDAFWAKDSTAELYHFIGKDIVNFHALFWPAMLEGSGYRKPTGIAVHGY
LTVNGQKMSKSRGTFIKARTYLDHLSPEYLRYYYASKLGRGVDDLDLNLEDFVQKVNSDL
VGKVVNIASRCAGFIHKGNAGVLVAENAAPELTDAFLAAAPSIADAYEARDFARAMREIM
GLADRANAWIADKAPWSLNKQEGKQAEVQAICATGVNLFRQLVIFLKPVLPLLAADAEAF
LNVPPLTWNDHATLLSNHQLNEFKPLMTRIDPVKVQAMTDASKEDLEASKTDTGDAAPAG
NGELAKDPLSPEIDFDAFAAVDLRVALIIKAEAVEGADKLLRLTLDIGDEQRNVFSGIKS
AYPDPSKLDGRLTMMIANLKPRKMKFGISEGMVMAAGPGGEEIYLLSPDSGAKPGQRIK
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagtacatccagaccgatatgtgggtgcgcttccagaagcatcgcggcaatcaa
tgcatttatgtctgcgcggacgacgcccacggttcggccatcatgttgcgcgccgagaag
gaaggcatcaccccggaacaactgatcgccaacgtccaggctgaacacagcgccgacttt
gccgagttcctggtggatttcgataacttccactcgacccactccgaagaaaaccgcgag
ctgtcgagccagatctacctgcgcctcaaagacgccgggcacattgccacgcgttcgatc
acccagtatttcgacccggaaaagaaaatgttcctggccgaccgcttcatcaagggcacc
tgcccgaaatgcggcactgaggaccagtacggcgacaactgcgagaaatgcggcgccacc
tacgcgcctaccgacctgaaggatccgaagtcggcgatctctggcgccaccccggtgctc
aaggattcccagcacttcttcttcaagctcccggatttccagcagatgctgcaaacctgg
acccgcagcggcaccctgcaggacgccgtggcaaacaagatcgccgaatggctggacgcc
ggcctgcagcagtgggacatctcccgcgatgcgccgtacttcggttttgaaatcccgggt
gagccaggcaagtacttctacgtatggctggacgcgccgattggctacatggccagcttc
aaaaacctgtgcgaccgcaagccggagctggacttcgacgcgttctgggccaaggactcc
actgccgagctgtatcacttcatcggcaaggacatcgtcaacttccacgcgctgttctgg
ccggcgatgctcgaaggttcgggctaccgcaagccgaccggcatcgcggtacacggctac
ctgacggtcaatggccagaagatgtccaagtcccgtggcacctttatcaaggcgcgcacc
tacctggaccacctgtcgccggaatacctgcgctactactacgcctccaaactgggccgt
ggcgtcgacgacctggacctgaacctggaagacttcgtacagaaggtcaactcggacctg
gtgggcaaagtcgtcaacatcgccagccgttgcgccgggtttatccacaagggcaacgcc
ggtgtgctggtggcggaaaacgccgcgccggagctgaccgacgcgttcctggccgctgcc
ccgagcatcgccgacgcctatgaagcccgcgactttgcccgcgccatgcgcgagatcatg
ggcctggccgaccgtgccaacgcctggatcgccgacaaggcgccgtggtcgctgaacaag
caggaaggcaagcaagctgaagtccaggcaatctgcgccacaggcgtcaacctgttccgc
cagttggtgatcttcctcaagccggtactgccactgctggcagccgacgccgaggcgttc
ctcaacgtgccgccgctgacctggaacgaccacgcgaccttgctcagcaaccatcagttg
aatgagttcaagccgctgatgacccgtatcgatccggtaaaagtccaggccatgaccgat
gcttcgaaagaagacctcgaggccagcaagactgacaccggcgatgcagcacctgcgggc
aatggcgagctggcgaaagatccgctgtcgccagaaatcgacttcgacgccttcgctgcg
gtggacctgcgggtggccctgatcatcaaggccgaagccgtggaaggcgctgacaagctg
ctgcgcttgactctggacatcggtgacgagcaacgcaacgtgttctccgggatcaagagt
gcctatccggatccgtccaagctcgatggtcgcctgaccatgatgatcgccaacctcaag
ccacggaaaatgaagttcggtatctccgagggcatggtgatggcggccggccctggcggt
gaagagatctacctgttgagcccggacagcggcgccaagccgggtcagcgcatcaagtaa

DBGET integrated database retrieval system