KEGG   Pseudomonas yamanorum: AK972_1251Help
Entry
AK972_1251        CDS       T05821                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pym  Pseudomonas yamanorum
Brite
KEGG Orthology (KO) [BR:pym00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AK972_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMW82051
UniProt: A0A143GCZ0
Position
complement(1333209..1334825)
Genome map
AA seq 538 aa AA seqDB search
MATPSLTASTASVTNDPKPRLDKKPGLVTVIVFFAVLAMGLLFTAYSLMHDMHELGTVVT
TWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTNSLPPHFAVVWSGFFNFLGVLLS
SGAVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSI
IGVGVANALMHGRDGTSGVDWGQAIKIGYALLLSPLIGFAFAALLLLALRAFVKNRSLYK
APKGDTPPPWWIRGMLIATCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPAG
ESLQFAAVAEVTQAALVKAAPQLAPADSRATLSTYVRTKEATPELVPALASITGHIGEEV
KSYGSLAAVPAEAVGNVRNDMYLTSETIRLMDKGKVGNFDADTQNKLQLFKQQIDNATRF
IPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAEMVAMLTIGAADMYG
LPVSTTHVLSSGVAGTMVANGGGLQMKTIRNLLMAWVLTLPAAILLSGSLYWLFTKLF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccttcgctgaccgcctccaccgcctccgtcaccaacgaccccaaaccgcgc
ctggacaagaaacccggcctggtgacggtgatcgttttcttcgccgtactcgccatgggc
ctgttgttcaccgcctacagcctgatgcacgacatgcacgagctcggcacggtggtcacc
acctggacgccgttcctgctgctgggtgtggcgctgttgattgccctgggcttcgagttc
gtcaacggtttccacgacaccgccaacgcggtggccacggtgatctacaccaactcgttg
ccgccgcatttcgcggtggtgtggtcgggctttttcaacttcctcggcgtgctgctgtcc
agcggcgcggtggcgttcggcatcatcgccctgctgccggtggagctgattctgcaggtc
ggctcctcggccggctttgcaatgatcttcgcgctgttgatcgccgcgatcctgtggaac
ctcggcacctggtggctgggtttgccggcgtcgtcgtcccacaccttgatcggctcgatc
atcggcgtgggcgtggccaacgctctgatgcatggccgtgacggcaccagcggtgtggac
tggggccaggcgatcaagatcggttacgcactgttgttgtcgccgctgatcggcttcgcc
ttcgccgccctgctgttgctggcgctgcgggctttcgtgaaaaaccgttcgctctacaag
gcgccgaaaggcgataccccgccgccttggtggattcgcggcatgctgatcgccacctgc
accggtgtgtcgtttgcccacgggtccaacgacggccaaaagggcatgggcctgatcatg
ttgatcctggtaggcaccctgccgatggcctacgcgctgaaccgcaccatgccggccggt
gagtcgttgcagtttgccgccgtggccgaagtgacccaggcagccctggtaaaagcggcg
ccgcaactggcgcctgccgactcgcgcgccaccttgtcgacctacgtacgcaccaaggaa
gccacgccggaactggtgcccgccctcgcctccatcaccgggcatatcggtgaagaagtg
aagagctacggctccctcgccgccgtaccggccgaggccgtgggcaacgtgcgtaacgac
atgtacctgaccagcgaaaccatccgcctgatggacaagggcaaggtcggcaacttcgac
gccgacacccagaacaagctgcaactgttcaagcaacagatcgacaacgccacacggttt
atcccgctgtgggtcaagatcgccgtggccatcgccctcggcctgggaaccatggtcggc
tggaagcgcatcgtggtgaccgtgggcgagaagatcggcaagacccacctgacctacgcc
cagggcgcctcggccgagatggtggcgatgctgaccatcggcgcggcggacatgtatggt
ttgccggtgtccaccacccatgtgctgtcgtccggtgtggccgggaccatggtggcgaat
ggtggtgggttgcagatgaagaccatccgcaacttgctgatggcctgggtgctgacattg
ccggcggcgattctgttatcgggtagcctgtactggctattcaccaagttgttctga

DBGET integrated database retrieval system