KEGG   Pseudomonas yamanorum: AK972_1926Help
Entry
AK972_1926        CDS       T05821                                 

Definition
(GenBank) 6-hexanolactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00903  Limonene and pinene degradation
pym00930  Caprolactam degradation
pym01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AK972_1926
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AK972_1926
Enzymes [BR:pym01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AK972_1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase Peptidase_S9 DUF3089
Motif
Other DBs
NCBI-ProteinID: AMW82726
UniProt: A0A143GFU2
Position
complement(2107380..2108315)
Genome map
AA seq 311 aa AA seqDB search
MAFTPLVQAHLDAWVACAADFGPFLTGQETTLTLNEQRKAYEQVLCSHPIPAGVSFCDVD
MGGVPGMMVVPDGCEGDRVLLYIHGGGYVGGSPRGYLGLAGHFAKLLGAKVYLPDYRLAP
EHPFPVPIDDTLQAYRWLLDQGNDPRSIVFSGDSAGGAMVVSVMVKARNAGLPLPAGGAA
LSPWANLEHTGASIDNRDGLDPQASRLGLTLLAKAFLNGALPNDPDASPVFADVRGLPPI
LVQIGENEVMLSDAMRLATHLGENRVRVSLEVWPGMFHVWHLFAAILPEGMQAVANAALF
LDQAIRGSRSA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcattcactccccttgtccaggcccatctcgacgcatgggttgcctgcgccgctgac
tttggcccatttctcacgggccaggaaaccaccctcaccctcaacgagcagcgcaaggct
tatgagcaggtgctttgttcccatccgattcccgccggtgtcagcttttgtgacgtcgat
atgggtggcgtaccgggcatgatggtcgtgcctgatgggtgtgagggggaccgggtgctg
ctttacatccacggcggtggttatgtcggcggcagcccgcggggctacctgggccttgcc
ggccacttcgcaaaactgctgggtgcaaaggtctacctgcccgactaccgcctggcgccc
gagcatccgttccccgtgcctattgatgatacgttgcaggcctatcgctggctgctcgac
caaggcaatgaccccaggtccatcgtgttctcgggcgattcggccggcggcgcgatggtg
gtgtcggtgatggtcaaggcccgcaacgcaggcctgccactgcccgccgggggcgccgcc
ttgtcgccgtgggccaacctggaacacaccggcgcctcaatcgacaaccgtgacggcctc
gacccgcaagcctcccgcctggggctgacgctgcttgcaaaagcgtttctcaatggtgcg
ctgccgaatgatcccgatgcatcgccggtgttcgcggacgtcaggggattgccgcccatt
ctggtgcagatcggcgaaaacgaagtcatgctcagcgacgccatgcgcctggccacccat
ctgggggaaaaccgggtacgcgtgtcgctggaggtttggcccgggatgtttcatgtctgg
catttgtttgcggcaatcttgcccgaaggcatgcaggctgtggcgaatgcggcgttgttt
ctggaccaggcaatacgtggcagccgtagcgcttga

DBGET integrated database retrieval system