KEGG   Pseudomonas yamanorum: AK972_2745Help
Entry
AK972_2745        CDS       T05821                                 

Definition
(GenBank) Aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00620  Pyruvate metabolism
pym00630  Glyoxylate and dicarboxylate metabolism
pym01100  Metabolic pathways
pym01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK972_2745
   00630 Glyoxylate and dicarboxylate metabolism
    AK972_2745
Enzymes [BR:pym01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AK972_2745
    1.2.1.22  lactaldehyde dehydrogenase
     AK972_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AMW83545
UniProt: A0A143GGY4
Position
complement(3058021..3059454)
Genome map
AA seq 477 aa AA seqDB search
MSSVPVYQNFINGRFTPSDAHLDVLNPATGVLLSKVPAATAEDVDQALAAARHAQKDWAR
KPAIERAGHLRRIAAKLRENVGHLARTITLEQGKVSGLAEVEVNFTADYLDYMAEWARRI
EGEIITSDRHNENIFLFRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVIKPSEETP
NNCFEFAKLVAETDLPAGVFNVVCGDGRVGGALTAHKGVDMISFTGSVATGSRIMAAAAP
NITKLNLELGGKAPAIVLADADLDLAVNAIRDSRIINSGQVCNCAERVYVERKVADQFIE
RISAAMAATRYGDPIAQADVEMGPLINRQGLDSVNRKVRTALSQGASLVTGGQIADLGQG
FHFQPTVLAGCHAAMEIMREEIFGPVLPIQIVDDLDEAIAMANDCDYGLTSSIYTRDLGK
AMKAVRELSFGETYINRENFEAMQGFHAGVRKSGIGGADGKHGLYEYTHTHAVYLQG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgtaccggtctaccagaacttcatcaatggccgctttaccccgagcgatgcc
cacctggatgtgttgaacccggccaccggcgtcctgctgtcgaaagtcccggcggccacc
gccgaagacgtcgaccaggccctggccgctgcccgccatgcgcagaaagactgggcgcgc
aagccggcgatcgaacgcgccgggcacttgcgccgcatcgccgccaagctgcgggaaaac
gtcggtcacctggcgcgcaccattaccctggagcaaggcaaggtcagcggcctggcggaa
gtggaagtcaacttcaccgccgactacctcgactacatggccgagtgggcgcgccgcatt
gaaggcgagatcatcaccagtgaccgccacaacgaaaacatcttcctgttccgcaaaccc
ctgggggtggtggccggtatcctgccgtggaatttcccgttctttttgatcgcccgcaag
atggccccggcgttgctgaccggcaacaccatcgtgatcaaacccagcgaagaaacgccg
aacaactgcttcgagttcgccaaattggtggccgagacggacctgccggccggggtattc
aatgtggtgtgcggcgatggccgcgtcggtggcgccctcaccgcccataagggcgtggac
atgatcagcttcaccggcagcgtcgccaccggctcgcggatcatggctgctgcggcaccg
aatatcaccaagctcaacctggaactgggcggcaaggcaccggccattgtcctcgccgat
gccgacctggacctcgcggtaaacgccattcgcgactcgcggatcatcaacagcggccag
gtgtgcaactgcgccgaacgggtgtacgtggagcgcaaagtcgccgaccagtttatcgag
cgcatcagcgccgcgatggccgccacccgctacggcgaccccatcgcccaggccgatgtg
gagatgggcccactgatcaaccgccaaggactggacagcgtcaatcgcaaggtacgcacc
gccttgagccagggtgcatcgctggtcaccggtgggcagatcgccgatctgggccagggg
tttcacttccagccgacggtattggccggttgccacgccgccatggaaatcatgcgcgaa
gaaatttttggcccggtgctgccgatccagattgtcgacgacctggatgaggcgatcgcc
atggccaacgactgcgactacggcctgacctcctcgatctacacccgcgacctgggcaag
gcgatgaaggcggtgcgcgaattgtcgtttggcgaaacctacatcaaccgcgagaacttc
gaggcgatgcaaggcttccatgccggcgtgcgcaaatccggaatcggcggcgccgacggc
aagcacggcctgtatgagtacacccatacccatgcggtgtacctgcagggctga

DBGET integrated database retrieval system