KEGG   Pseudomonas yamanorum: AK972_3360Help
Entry
AK972_3360        CDS       T05821                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00051  Fructose and mannose metabolism
pym00520  Amino sugar and nucleotide sugar metabolism
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AK972_3360
   00520 Amino sugar and nucleotide sugar metabolism
    AK972_3360
Enzymes [BR:pym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AK972_3360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding DNA_pol_D_N
Motif
Other DBs
NCBI-ProteinID: AMW84160
UniProt: A0A143GJ82
Position
complement(3736260..3737687)
Genome map
AA seq 475 aa AA seqDB search
MIPVILSGGSGTRLWPLSRALKPKQFIALHGDLSLFQATLDRIKHLSIEGENVSPPIIVC
NEEHRFIVAEQSRSLDLIPQKILLEPTARNTAPAIAAATLSALQDGDDPILLVLAADHVI
GDTGAFNAALTLAAVEVNKGKIVTFGVVPTKPETGYGYIRTQAAALDGAAHVEAFVEKPD
LETAQSYLAQGNYFWNSGMFMFRASVMKAELERLSPEIMVAAELSLSNATHDQDFTRLNQ
VDFVNAPNVSIDYAVMEKTDIASVVILNSPWSDLGAWDSVWEAGLKDQNQNCTQGDVLLQ
DVTNSYVHASHRLVTVAGINDVVVVETADAILVTTKDHAQDVKKIVAQLTEKHRIESASH
REVYRPWGKYDSVDQGYRYQVKRITVKPGHKLSVQLHHHRAEHWIVVSGTANVQIADKQV
LLTENQSTYIPIGVVHSLENPGRIPLELIEVQSGSYLGEDDIIRFEDRYGRLELV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatcccagtgatattgtctggcggctcaggcacgcgcctgtggccgctttctagagca
cttaagccaaagcagtttatagcgctgcacggtgacttgagtttgtttcaagccacgttg
gaccgcatcaagcacctgtcgatagagggcgagaacgtcagccctccgatcattgtgtgc
aacgaagaacaccgtttcatcgtggccgagcaaagtcgatcgctggacttgataccccag
aaaatccttcttgaacccacggcccggaataccgctccggcgattgccgccgcgacgttg
tcagccctgcaagacggcgatgacccgatcctgctggtgttggcggcagaccatgtgatc
ggcgataccggcgcctttaatgcggccttgacgctggccgcggtggaggtcaacaagggc
aaaatcgttaccttcggcgtggtgcctaccaagccggagactggctatggctatatccgc
actcaagccgctgccctcgatggcgcggcgcatgtcgaggcctttgtcgaaaagcccgac
cttgagaccgcacaaagctacctggcccaaggcaactacttctggaacagcggcatgttc
atgttccgcgcttccgtgatgaaggctgagctggagcgcttgagcccggagatcatggtg
gccgcggagctgtccctctccaatgcgacgcacgaccaggatttcacccggctcaaccag
gtggatttcgtgaacgcgcccaacgtgtcgattgactacgcggtgatggaaaaaaccgac
atcgcgtcggtggtcatcctcaattccccctggagcgacctgggtgcctgggactcggtc
tgggaagcgggcctcaaggaccagaaccagaactgcacccaaggcgacgtgctgctgcaa
gacgtgaccaacagctatgtgcatgccagccaccgcctggtcaccgttgccgggatcaat
gatgtggtggtggtcgagaccgccgacgcgatcctggtgaccaccaaggatcatgcgcaa
gacgtcaagaaaatcgtcgcgcagctcactgaaaagcaccggatcgagagcgccagtcac
cgcgaagtctatcggccgtggggcaaatatgactcggtggaccaggggtatcgctaccag
gtgaagcggatcacggttaagccggggcacaagctgtcggtgcagctccaccaccatcgg
gctgagcactggatcgtggtgtccggcaccgcgaatgtgcagatcgccgacaagcaggtg
ctgctcaccgaaaaccaatccacctacattcccattggcgttgtgcactccctggaaaac
ccgggacgcatcccgctggagctgattgaagtccagtccggctcctacctgggcgaagac
gacatcatccgctttgaagaccgctatggccgcctcgagcttgtttaa

DBGET integrated database retrieval system