KEGG   Pseudomonas yamanorum: AK972_4682Help
Entry
AK972_4682        CDS       T05821                                 

Definition
(GenBank) Histidine ABC transporter, ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
pym  Pseudomonas yamanorum
Pathway
pym02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pym00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AK972_4682
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pym02000]
    AK972_4682
Enzymes [BR:pym01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AK972_4682
Transporters [BR:pym02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AK972_4682
   Histidine transporter
    AK972_4682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 APS_kinase AAA_16 G-alpha PRK AAA_33 AAA_13 AAA_23 RsgA_GTPase AAA_22 AAA_25
Motif
Other DBs
NCBI-ProteinID: AMW85482
UniProt: A0A143GMQ9
Position
5164822..5165586
Genome map
AA seq 254 aa AA seqDB search
MYKLTVEGLHKSYGDNEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAM
TLDGQQIRMVSDRHGMRVADDAELQRLRTRLAMVFQHFNLWSHMSVLENITMAPRRVLGC
SKKDAEDRARRYLDKVGLPARVADQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSAL
DPELVGEVLKVIQGLAEEGRTMIMVTHEMSFARKVSSQVLFLHKGLVEEQGAPEDVLGNP
KSERLQQFLSGNLK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaattgaccgttgaaggcctgcataaaagctatggcgacaatgaggtgctcaaa
ggtgtctcgctcaaggccaagaccggtgatgtgatcagtttgatcggcgccagtggctcg
ggaaaaagcacctttttgcgctgcatcaactttcttgaacagccgaatgacggcgccatg
accctggatgggcagcagattcggatggtcagcgaccgccatgggatgcgcgtggcggat
gatgcggagttgcagcgcctgcgtacgcggttggcgatggtgtttcagcatttcaacctg
tggagccatatgagtgtgctggagaacatcaccatggcgccgcgccgggtgctgggttgc
agcaagaaagacgccgaggaccgggctcgccggtatctggacaaggttgggttgccggcg
cgggtggcggatcagtatccggcgtttttgtcggggggccagcaacagcgggtggcgatt
gcccgggcgttggcgatggagccggaggtgatgctgtttgacgagccgacttcggcgctg
gatccggagttggtgggtgaggtgttgaaggtgatccaggggttggctgaggaaggccgg
acgatgatcatggtgacccatgagatgagctttgcccgcaaggtgtcgagccaggtgctg
tttttgcacaagggattggtggaggaacagggtgcgccggaggatgtgctgggtaatccg
aagagcgaacggttgcagcagtttttgagtgggaatttgaagtag

DBGET integrated database retrieval system