KEGG   Pseudomonas yamanorum: AK972_5680Help
Entry
AK972_5680        CDS       T05821                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pym  Pseudomonas yamanorum
Pathway
pym00010  Glycolysis / Gluconeogenesis
pym00020  Citrate cycle (TCA cycle)
pym00620  Pyruvate metabolism
pym01100  Metabolic pathways
pym01110  Biosynthesis of secondary metabolites
pym01120  Microbial metabolism in diverse environments
pym01130  Biosynthesis of antibiotics
pym01200  Carbon metabolism
Module
pym_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AK972_5680
   00020 Citrate cycle (TCA cycle)
    AK972_5680
   00620 Pyruvate metabolism
    AK972_5680
Enzymes [BR:pym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     AK972_5680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33 AAA_25 AAA_16 AAA_29
Motif
Other DBs
NCBI-ProteinID: AMW86480
UniProt: A0A145XDU9
Position
complement(6297335..6298876)
Genome map
AA seq 513 aa AA seqDB search
MTQANNAVYTDLSVDDLVKEALQRGEGVLADTGALVVETGHRTGRSPVDRFIVEEPSTQA
AIAWGPINRKFPADKFDALWARVEAFNNAQEHFVSHVHVGAAEDHYLAVKMTTQTAWQNL
FGRCLFINPAQYNPAGREEWQVLNVANFECVPERDGTNSDGCVILNFAQKKVLIAGMRYA
GEMKKAMFSVQNFLLPASDVLPMHCAANIGEAGDVTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIKHGAVLENVVIDDAKHADYADVSL
TQNSRAAYPLEHVAKRSEKNLGGEPNAVIFLTCDLTGVLPPVSILSEEQAAYHFLSGYTA
LVGSTEMGSGAGIKSTFSTCFGAPFFPRPAGEYAELLIKRIRGFGSKVYLVNTGWTGGGY
GVGKRFNIPTTRGVIAAIQSGALIGAETEHLDTINLDVPLAVPGVETGLLNPRNTWADKA
AYDEAAKALAGLFVENFKKFEVSDAIKAAGPKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccaataacgccgtatacaccgatctgagtgttgacgatctggtcaaagaa
gccctgcagcgcggtgaaggcgtgcttgccgataccggcgcgctggtcgtagaaaccggt
catcgtaccggccgttcgccagtcgaccgcttcattgttgaagagccttccacccaggct
gccattgcctggggcccgatcaaccgcaagttcccggccgacaagttcgatgccctgtgg
gctcgcgtcgaggcattcaacaacgcgcaagagcatttcgtttcccacgttcacgtaggg
gctgcagaagaccactacctggccgtgaaaatgaccacccagactgcctggcagaacctg
ttcggtcgttgcctgttcatcaacccggcccagtacaaccccgccggtcgtgaagagtgg
caagtgctcaacgtagccaacttcgaatgcgtgccagagcgtgacggcaccaactccgac
ggttgcgtgatccttaactttgcccagaaaaaagtgctgatcgccggcatgcgttacgcc
ggtgagatgaaaaaagccatgttctcggtgcagaacttcctgctgccggcctccgacgta
ctgccgatgcactgcgccgccaacatcggcgaagcaggcgacgtgaccctgttcttcggc
ctgtcgggcacgggtaaaaccaccctgtccgccgacgaaagccgctacctgatcggcgac
gacgaacacggctggggcgaaggtgttgtgttcaacatcgaaggcggttgctatgccaaa
tgcatcgacctgtccgagaagaacgagccggttatctggaaagccatcaagcacggcgcc
gtgctggaaaacgtcgtcatcgatgacgccaagcacgccgactacgctgacgtcagcctg
acccagaacagccgcgccgcctacccgctggaacacgttgccaagcgctccgagaaaaac
ctcggtggcgagccaaacgccgtgatcttcctgacctgcgacctgaccggcgtactgccg
ccagtctcgatcctcagcgaagaacaagcggcctaccacttcctgtctggctacaccgca
ctggtgggctcgaccgaaatgggttcgggcgccggcatcaagtcgacattctccacctgc
ttcggcgcgccgttcttcccgcgcccggccggcgaatacgcagagctgctgatcaagcgc
atccgcggcttcggctccaaggtctacctggtcaacaccggctggaccggcggtggctac
ggcgttggcaagcgcttcaacatcccgaccacccgtggcgtgattgcagcgatccagagc
ggtgcgttgattggtgccgagaccgagcacctcgataccatcaacctggacgtgccattg
gctgtaccgggcgtcgagactggcctgttgaacccacgtaacacctgggctgacaaggct
gcctacgatgaagccgccaaggcgctggcgggtctgttcgttgagaacttcaagaagttt
gaagtgagcgatgcgatcaaggctgcgggtccgaagttgtaa

DBGET integrated database retrieval system