KEGG   Pyrococcus sp. NA2: PNA2_0429Help
Entry
PNA2_0429         CDS       T01487                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pyn  Pyrococcus sp. NA2
Pathway
pyn00010  Glycolysis / Gluconeogenesis
pyn01100  Metabolic pathways
pyn01110  Biosynthesis of secondary metabolites
pyn01120  Microbial metabolism in diverse environments
pyn01130  Biosynthesis of antibiotics
pyn01200  Carbon metabolism
pyn01230  Biosynthesis of amino acids
Module
pyn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pyn_M00002  Glycolysis, core module involving three-carbon compounds
pyn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PNA2_0429
Enzymes [BR:pyn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PNA2_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEC51346
UniProt: F4HK34
Position
360693..361697
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVAYAVMKQDDMELVGVTKTKPDFEAYRAKELGIDVYAASEEFLP
RFEKAGFEVAGTLNDLLEKVDIIVDATPGGVGAKNKQLYEKAGVKAIFQGGEKADVAEVS
FVAQANYESAIGKNYVRVVSCNTTGLVRTLNALREYIDYVYAVMIRRAADPNDTKRGPIN
AIKPTVEVPSHHGPDVQTVIPVNIETMAFVVPTTLMHVHSIMIELKKPITEKDVIDIFEN
TTRVLLFEKEKGFESTAQIIEFARDLHREWNNLYEIAVWKESISVKGNRLFYIQAVHQES
DVIPENIDAIRAMLELADKEESIRKTNKSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaggtcggaataaatggatatggaactatagggaagagagttgcatacgct
gtaatgaagcaggacgacatggagctagtgggagttacaaaaacaaaaccagattttgaa
gcctacagagcaaaggaacttggaatagatgtttatgcagcgagtgaggagttcttgcca
agattcgagaaagcgggattcgaggttgctggaacacttaatgatcttcttgagaaagtc
gacataatagttgatgcaactcctggaggagttggagcaaagaacaagcaactatatgaa
aaggcaggtgtcaaggcaatattccaaggaggagagaaggcagatgtggctgaagtttcc
tttgttgcccaagcaaattatgagagtgcaattggaaagaactatgttagggtagtgtca
tgtaataccacagggctcgtcagaacacttaatgcccttagagagtacatagactatgta
tatgcggttatgataaggagagccgcagatccaaacgatacaaagagaggaccaataaat
gcaatcaagccaaccgttgaagttccttctcatcacggaccagacgtccaaactgtaatt
cccgttaacattgagacaatggccttcgttgtgccaacaacattgatgcatgttcactcg
ataatgatagaacttaagaagccgattacagagaaggacgttatagacatcttcgaaaac
acaacaagagttctcctatttgagaaagagaaaggatttgagagtactgcccagataata
gaatttgcaagagatctacacagagaatggaataacctatacgagattgcagtgtggaaa
gagagcataagcgttaaaggaaacagattattctacatccaagctgtacaccaagagagt
gatgttattcctgagaacatagatgcaataagggcgatgcttgaactagccgataaggaa
gagagcataaggaagacaaataagagcctcggaattctcaaatga

DBGET integrated database retrieval system