KEGG   Plasmodium yoelii: PY17X_0935700Help
Entry
PY17X_0935700     CDS       T01035                                 

Gene name
PY00731
Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pyo  Plasmodium yoelii
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PY17X_0935700 (PY00731)
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PY17X_0935700 (PY00731)
Protein kinases [BR:pyo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PY17X_0935700 (PY00731)
Chromosome and associated proteins [BR:pyo03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PY17X_0935700 (PY00731)
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY17X_0935700 (PY00731)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 3791836
NCBI-ProteinID: XP_726495
UniProt: A0A077Y535
Position
9
AA seq 528 aa AA seqDB search
MLKKKKECSGIEREEKNTKKKNNASECLSMQNDDSTYIDSNEEDKNGEYINENTKENIKN
NDNINKKSDEKEYNASETKKTNNNEKNKNNSNNKTSKINDEKGKDEKINIKEAIIKNVRV
PDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKS
DYIIRLYDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEEHIKTILYNLLLGEKF
IHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINSEKDVNIVNDLEENEEPGPHNKNL
KKQLTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRFPLFP
GSSCFPLSPDRNSKKVHEKSNRDQLNIIFNIIGTPTEDDLKNIKKPEVIKYIKLFPHRKP
INLKQKYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKNLENFSTKKIILP
FDDWMILSETQLRYIFLKEVQSFHPELVIPSAFTIHESNFYNNEEPSS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaaaaagaatgctctggaattgaaagagaggaaaaaaatacaaaaaaa
aaaaacaatgcttcagaatgtttaagcatgcaaaatgatgatagcacatatatagatagc
aatgaagaagataaaaatggggaatacataaatgagaacacaaaagaaaatataaaaaat
aacgacaatattaataaaaagtctgacgaaaaggaatacaacgcatccgagacaaaaaaa
accaataataacgagaaaaacaaaaataatagtaacaataaaactagcaaaataaatgat
gagaaaggaaaagatgaaaaaataaatataaaagaagctattataaaaaatgtgcgtgta
ccagataattacataattaagcatttaataggaagagggtcgtatgggtatgtatattta
gcttatgataaaaatacagaaaaaaatgttgcaataaaaaaggtaaatcgaatgtttgaa
gatttaattgattgtaaaagaatattaagagaaataacaattttgaataggctaaaaagt
gattatattataagattatatgatttaataatacctgaagatttattaaaatttgatgaa
ttatatatagtattagaaatagctgattcagatttaaaaaaattatttaaaaccccaata
tttttgacagaagaacatataaaaactatattatataatttattattaggtgaaaaattt
attcacgaatcaggtattatccatagagatttaaaaccagctaactgtttattaaaccaa
gattgttctgttaaagtatgtgattttggtttagctagaacgataaatagtgaaaaagat
gttaatatagtaaatgatttagaagaaaatgaagaaccaggaccacataataaaaattta
aaaaaacaattaactagccatgtagttactagatggtatagagcccctgaattaatattg
ttacaagaaaattatactaaatctatagatatatggtctactggttgtatttttgcagaa
ctattaaatatgttacaaagccatattaatgatcccactaatagatttcctttatttcca
ggatcttcttgttttccactatctccagaccgtaattcaaaaaaagtacatgagaaaagt
aatagagaccaattaaatattatttttaatatcataggtacacctacagaagatgatctt
aaaaatattaaaaaacctgaagttataaaatatattaaattgttcccgcacagaaaacct
ataaatctaaagcaaaaatacccatctatttcagatgatggaatcaatttattagaatca
atgttaaaatttaatccaaataaaagaatcacaattgaccaagctttagatcatccttat
ctaaaagatgttagaaaaaaaaatttagaaaatttctcaacaaaaaaaattattcttcct
tttgatgattggatgattttatctgaaacacaattgagatatatatttttaaaagaagtg
caatcctttcatcctgaattagttataccttctgcatttactatacacgaaagtaatttc
tataacaatgaggaacctagtagttaa

DBGET integrated database retrieval system