KEGG   Plasmodium yoelii: PY17X_1404200Help
Entry
PY17X_1404200     CDS       T01035                                 

Gene name
PY01533
Definition
(RefSeq) DNA ligase I, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pyo  Plasmodium yoelii
Pathway
pyo03030  DNA replication
pyo03410  Base excision repair
pyo03420  Nucleotide excision repair
pyo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PY17X_1404200 (PY01533)
   03410 Base excision repair
    PY17X_1404200 (PY01533)
   03420 Nucleotide excision repair
    PY17X_1404200 (PY01533)
   03430 Mismatch repair
    PY17X_1404200 (PY01533)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pyo03032]
    PY17X_1404200 (PY01533)
   03400 DNA repair and recombination proteins [BR:pyo03400]
    PY17X_1404200 (PY01533)
Enzymes [BR:pyo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PY17X_1404200 (PY01533)
    6.5.1.6  DNA ligase (ATP or NAD+)
     PY17X_1404200 (PY01533)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PY17X_1404200 (PY01533)
DNA replication proteins [BR:pyo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PY17X_1404200 (PY01533)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PY17X_1404200 (PY01533)
DNA repair and recombination proteins [BR:pyo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PY17X_1404200 (PY01533)
   NER (nucleotide excision repair)
    Other NER factors
     PY17X_1404200 (PY01533)
   MMR (mismatch exicision repair)
    Other MMR factors
     PY17X_1404200 (PY01533)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 ICE2
Motif
Other DBs
NCBI-GeneID: 3801864
NCBI-ProteinID: XP_022812804
Position
14
AA seq 898 aa AA seqDB search
MKLLLLILLTKMFFCKIKRYMRTEYNYVTPFMKSKLFHNYKNKFNVIVLKNIRNNVPNRN
DKYLKCLSFPKKMDGDEQCDTKIEESHVKSEEKEASKRKNTNDDGAKTKKSKVKNENEIK
KGSLFNCKVYEDEKISDLSSPKFNPANFDISNLCLSEKDKIKHKFKDSLLFTFLTNTFNQ
IEELKGSGAGSKKNVAIILSNVFRVLIYYSPNDLIPAVYITLNKVAPDYQNVEAGVGEAL
ILKTMSEAYSRTEASIKKDLQQIEDLGIIAESCSCKMRTIFPLPRLTIQSVFNELKSIPN
ISGSNSQQKKREVIKKLLVSAKTSEAKYIVRFLQQRLRIGVNSATVLQALAYAFVLTRPE
IPENIIKDGKMMNEKLLNERIVVKGDKDNCDDDATEVKNENNIKLEKTNDTDNKTNVLDT
DQFNNLVKSIKIRNERMSKPNLFFNIGKEGDTRLLPIFKELKNAYCDINNDSDIFECMEK
SVKSALCELPNIEMIIQNLLSGDDMNVLMKKCTVKTGVPVQPMLAKPTKGIQEVLDRFNN
VTFTCEYKYDGERAQIHYIDKDNIKIFSRNLETMTEKYPDVIQIVKDQIMPGVTESIIDS
EVVAYDIENKKILPFQILTTRKRKDVDIENIKVKICLFPFDLICCNGVPVIKEPLEIRRK
LLYSLLRCKEGVLEYATHSEMNNIDDIDIFLQDAIENNCEGLMVKTLLDNASYEPSRRSL
NWLKVKKDYIEGLSDSVDLVPIAGYYGKGKRSGVYGAFVLAAYNSETENFQTVCKAGTGF
SDEILNALHESLSDKIIPNKKSYYEVSDKLNPDVWFDAHYVWEIKAADLSLSPVHTAAIG
VYSDDKGIGLRFPRFLRLRDDKNPEQATTAQQIVEFYEAQFASNKNKNNNYNDESGSE
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattattgctgatacttttaacaaaaatgtttttttgtaaaataaaaagatac
atgagaactgaatataattatgtaacaccatttatgaaaagcaaattgtttcacaattat
aaaaataagtttaatgtgatagttttaaagaatattagaaataacgtgccaaatagaaat
gataaatatttaaaatgtttatcctttcctaaaaaaatggacggggacgagcaatgtgat
actaaaatagaagagtctcatgttaaaagtgaagaaaaggaagcatcgaaaaggaaaaat
acaaacgatgatggtgcaaaaacaaagaaatcgaaagtaaagaatgaaaatgaaataaaa
aagggttcattatttaactgtaaagtttatgaggatgaaaaaataagtgatttatcatcg
ccaaaatttaatcctgccaattttgatataagtaatttatgcttatctgagaaggataaa
ataaaacacaagtttaaagattccttattattcacatttcttacaaatacatttaatcaa
attgaagaattaaaaggtagtggggcaggaagcaagaaaaatgtagctattattttatca
aatgtttttcgtgttttaatatattatagccctaatgatttaattccggcagtatacata
actttaaataaagtggcaccagattatcaaaatgtcgaagcaggtgttggtgaggcatta
atattaaaaacaatgtcagaagcatatagtagaactgaagctagtataaaaaaagatttg
caacaaattgaagatttaggaataatagcagaaagttgttcatgtaaaatgagaactata
tttcctttacctaggttaactattcaatcagtttttaatgaattaaaaagtataccaaat
attagtggttctaattctcaacagaaaaaaagagaagtaataaaaaaattattagttagt
gcaaaaacatcagaggcaaaatatatagttcgatttttacaacaacgtttaagaattggt
gtaaatagtgctactgttttgcaagctttggcatatgcttttgtattaacacgccctgaa
attccagaaaatatcataaaagacggtaaaatgatgaatgaaaaattgctaaatgagcga
atagtggttaagggtgataaagataattgtgatgatgatgcaacagaagtaaaaaatgaa
aataatataaaattagaaaaaacaaatgatacggataacaaaacaaatgtgttggatact
gatcaatttaataatttagtaaaatcaataaagatacgtaatgaaagaatgagtaaaccc
aacttgttttttaacataggaaaagaaggagatactcgtttattacctatatttaaagaa
ttaaaaaatgcatattgtgatataaataatgattcagatatttttgaatgtatggaaaag
tctgtaaaaagtgctttatgtgaattaccaaatattgaaatgattatacaaaatttatta
agcggtgatgatatgaatgtgttaatgaaaaaatgtactgttaaaaccggagttccagtg
cagcctatgttagctaaaccaacaaaaggaatacaagaagttttagatagatttaataat
gttacatttacgtgtgaatacaaatatgatggtgaaagagcccaaattcattatattgat
aaagataatataaagatttttagtagaaatttagaaacaatgacagagaaatatcctgat
gttattcaaattgtaaaagatcaaataatgccaggtgttactgaatcgattattgatagt
gaagttgtagcatatgatattgagaataaaaaaatattaccatttcaaatattaacaaca
agaaaaagaaaggatgtagatatagaaaacataaaagtgaaaatatgtttatttccattt
gatttaatatgttgcaatggggtacctgtaataaaagaaccattggaaattagaaggaag
ttattatattccttattaagatgtaaagaaggagtattagaatatgcaacacattcagaa
atgaataatattgatgatatagatatatttttacaagatgctattgaaaataattgtgaa
ggtttgatggttaaaactttacttgacaatgcttcttatgagccatcaagacgatcatta
aactggttaaaggtaaaaaaagattacatagaaggattatcagattcagttgatttagta
cctatagctggatattatggaaaagggaaaagaagtggggtttatggtgcttttgtttta
gctgcatataattctgaaacagaaaacttccagactgtatgtaaagcaggtacaggtttt
agtgatgaaatacttaatgcattgcatgaatcattaagtgataaaattatacctaataaa
aaatcatattatgaagtatcagataaactaaaccctgatgtgtggtttgatgctcattat
gtatgggaaattaaagcagcagatttatcattatcgcctgtccatactgcagctatcgga
gtgtattcagatgataaagggattgggttaagattcccaagatttcttagattgagggat
gataagaatccagaacaagcaacaacagctcagcagattgtcgaattttacgaagctcaa
tttgcctcgaacaaaaataaaaataacaattataacgacgaaagtggaagcgaatag

DBGET integrated database retrieval system