KEGG   Plasmodium yoelii: PY17X_1234900Help
Entry
PY17X_1234900     CDS       T01035                                 

Gene name
PY03802
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 2, putative
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY17X_1234900 (PY03802)
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PY17X_1234900 (PY03802)
Ubiquitin system [BR:pyo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PY17X_1234900 (PY03802)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH DUF2887
Motif
Other DBs
NCBI-GeneID: 3789330
NCBI-ProteinID: XP_022812692
Position
12
AA seq 1219 aa AA seqDB search
MSSLSDTSSNKTIILDNIQISNLFKIFDTFPFEPKNENETWYIVNKEFIDNLRNYESGKN
RSYDSLINNKIFIEDCDNEASTRTRLLKEYENGNGISFVLYPEKAIELLEKHFQFNVKIP
RSVYQHKTKRKDKIIFKVDIQPLKIVVYSKDTNEHSNPPQMKIVILRSDTIENVLKEIIS
DFDPKKFKKHLFYAEGIGENKETNWKCLYLSNSNDYPLNKKVYEYDIDEMSCLLITNERA
DIKCLTYDNEYSEYNMTSNNISGSVDDDTINNPKSISYIFENGGDRGLINLGNTCFLNSS
LQCLSKILKFTNYFLSGTFWDHINYCNPVGQHGRLAKAYYETLLEMWKINKKGKPYAPKV
LKQAISEKRDEFYGYQQHDSQELLAFLLDGLHEDLNLIQKKPYYEEKLQGGLDRPDIEVA
EASWKRHKEINNSIIVDLFQGQYRSRLQCPQCNKLSITFDPFMYLSIPLPPKKNHRIWFH
VMLSRDVQISLRFSSIFSGSQEVLKLKYNFINIITNLKKKKNSILLHTKNIIKNNKYSHE
NTNAFNFHTKFMDDTYESYEINNEGSSGNSINNKNNIDGCNYMRALKNKSKIKNTLNEED
INNIYEHICHMCNINTIDDIEISNLFFLYTRFKNLACNNFFQILNNNDIIAEPHTRTGKG
ISHIFVFMVPQNWPHLTDNNKNGNNYNDDNGKIRTSDSLTSSTSSVGKARNANSKDEDMY
IKNDSPNSNDKKYIQNKLHNNKLAKKRKGSLSSPSNSLRKGDKLHLDNEIGKVDDLENSN
DTITEYIKNELFNNDNKSLYLLIVPLCKDEQLLCKMKNNDLPFLVNTAYNITTRELYEKV
KNAYKKNSKFENIKMNQSRSNSINSGSYGNNHNGYGEKRLKNGDSEIGYYNENENNNKLY
HKNKNISNIYFDSNKKDNSPDISLNCSTNSTNLNIDESTNSYENKSTNDYYESYLDKIHL
YIPSYNLKDNWDAKDNLGFFLKCDETYLTDYIQISEQNKLIIIHLDTNSIKDELSVDIKT
LTLMDLEEKYSVDTCLKLFSEEEHLDEDNTWYCSNCKLHVQAYKKLDLFRMPIVLILHLK
RFNNSNRWLRTKIDSYVYYPHKENEYLDMTPYILPDGLKHMKSFDPNYLPLYELIGVNCH
TGGLGGGHYFAYVKLNGQWYNFNDTYVTTINESQINTKNAYLLFYQLHTYKNEKFTDIAH
HRNIAEEEAIRMANASYYN
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctatcggatacaagttcaaacaaaactatcatactggataatatacaaatt
tctaatctttttaaaatatttgatactttcccctttgagccaaaaaatgaaaatgaaaca
tggtatatagtaaacaaagaattcatagacaatttacgaaattatgaatctgggaagaat
agatcctatgatagcttgataaataataaaatatttatagaagattgtgataacgaggcc
agtacaagaactcgacttttaaaagaatatgaaaatggcaatggcataagttttgtttta
tatcctgaaaaagctattgagttattggaaaaacatttccaatttaatgtaaaaatacca
agatcagtttatcaacataaaacgaaaagaaaagataaaataattttcaaagtcgacatc
caaccgcttaaaattgttgtttattcaaaagatacaaatgagcactcaaacccccctcaa
atgaaaatcgttattttacgcagcgatactatagaaaatgttctaaaggagataatcagt
gattttgatcccaaaaaatttaaaaaacatttattttatgcggaaggtataggagaaaat
aaagaaacaaactggaaatgtttatacttaagtaatagcaatgattatcctttaaataaa
aaagtatatgaatatgatatagacgaaatgagttgtttattaataactaatgaaagggct
gatataaaatgcttaacatatgataatgaatatagtgaatataatatgacaagcaataat
atatcaggaagtgtagatgatgatacaataaataatcccaaatctattagttatatattt
gaaaatggtggtgatagaggattaataaatttaggtaacacatgttttttaaattcatca
ttacaatgtttatcaaagattttaaaatttacaaattattttttaagtggaacattttgg
gatcatataaattattgtaacccagttggacaacatggtcgactagctaaagcatattat
gaaacattattagaaatgtggaaaataaataaaaaaggaaaaccatatgctcctaaagtt
ttaaaacaagcaataagtgaaaagagagatgaattttatggatatcaacaacatgattca
caagaacttttagcatttttattagatggtcttcatgaagatttaaatttaattcagaaa
aaaccatattatgaagaaaaattacaaggagggttagatagaccagatatagaagttgca
gaagcatcatggaaaagacataaagaaattaacaattcaataattgttgatttatttcaa
ggacaatatagatcgagattacagtgtcctcaatgtaataaacttagtataacatttgat
ccttttatgtatttatcaattccattaccacctaaaaagaatcatagaatatggtttcat
gttatgttaagtagagatgttcaaatttctttgagattttcttctatttttagtggttct
caagaagtgttaaaattaaaatataatttcataaacattataacaaatttaaaaaaaaaa
aaaaattctatacttttacatacaaaaaatattattaaaaataacaaatattctcatgaa
aatacaaacgcttttaattttcataccaaatttatggatgacacatatgaaagttatgaa
ataaataatgagggaagttctgggaatagtataaataataaaaataatattgatgggtgt
aattatatgagagctttaaaaaataaatcaaaaataaaaaatacactaaatgaagaagat
ataaataatatatatgaacatatttgtcatatgtgtaatattaacacaatagatgatatt
gaaatttcaaatttattttttttatataccagatttaaaaatttagcatgtaataacttt
tttcaaatattgaataataatgatattattgctgaaccacacacaagaacaggaaaagga
attagtcatatatttgtttttatggttcctcaaaattggccacatttaactgataataat
aaaaatggaaacaattataatgatgataatggaaaaataagaacatcggatagtttaact
tcttcaacaagttcagttggaaaagcacgaaatgccaattcaaaagatgaggatatgtat
ataaaaaatgattcgccaaatagtaatgataaaaaatatattcaaaataaattacataat
aataagttagccaaaaaacggaaaggtagtttatcttcaccttcgaattctttaagaaaa
ggagacaaattacatttagataatgaaatagggaaagtagatgatttagaaaattcaaat
gatactataactgaatatataaaaaatgaactctttaataatgataataaatctttatat
ttgttaattgtgcctttatgtaaagatgaacaattattatgtaaaatgaaaaataatgat
ttgccttttttagtaaatactgcatataatatcacaacaagggagttgtacgaaaaagta
aaaaatgcatacaaaaaaaattcaaaatttgaaaacataaaaatgaatcaaagtagaagt
aacagtattaatagtggatcttatggaaacaatcataatgggtatggagaaaaacgatta
aaaaatggcgatagtgaaataggatattataatgaaaatgaaaataataataaattatat
cataaaaataaaaatatatctaatatatattttgatagtaataaaaaagataatagtcca
gatatcagtttaaattgttcaactaatagtacaaatttaaatattgacgaaagtacaaat
tcatatgaaaataaaagtaccaatgattattatgaaagctatttagataaaatacattta
tatataccttcttacaatttaaaagataattgggatgcaaaagataatttaggttttttt
ttaaaatgtgatgaaacatatttaacagattatattcaaatttcagaacaaaataaactt
attattatacatttagatactaattcaataaaagatgaattatctgttgatattaaaaca
ttaacactaatggatttagaagaaaaatatagtgttgatacatgtttaaaattattttca
gaagaagaacatttagatgaagataatacatggtattgtagtaattgtaaattacatgta
caagcatataaaaagttagatttatttagaatgccaattgtattaatcttacatctaaaa
agatttaataattcaaatagatggttaagaactaaaatagattcatatgtttattatccc
cataaagaaaatgaatatcttgatatgacaccatatatattaccagatggtttaaagcat
atgaaaagttttgatccaaattatttacctttatatgaactaataggagttaattgtcat
actggcggtttgggtggtggtcattattttgcttatgttaaattaaatggacagtggtat
aattttaatgatacatatgttacaacaattaatgaatctcaaattaacacaaaaaatgca
tatcttttattttaccaacttcatacttataaaaatgaaaagtttaccgatatagctcat
catagaaacatagcagaagaagaggctattcgaatggcaaatgcaagttactataattaa

DBGET integrated database retrieval system