KEGG   Plasmodium yoelii: PY17X_0417600Help
Entry
PY17X_0417600     CDS       T01035                                 

Gene name
PY03443
Definition
(RefSeq) arginase, putative
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00220  Arginine biosynthesis
pyo00330  Arginine and proline metabolism
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
pyo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PY17X_0417600 (PY03443)
   00330 Arginine and proline metabolism
    PY17X_0417600 (PY03443)
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PY17X_0417600 (PY03443)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3830671
NCBI-ProteinID: XP_725416
UniProt: A0A078K1H1
Position
4
AA seq 377 aa AA seqDB search
MYECIQNYLTKHIDEQNIYVKKCVSIIGSPLAAGQSLGGVNKACDNLRQLGLYDVIKAMG
WKYNDIGNIGESISINTFLNSANAEKGIKKEAEKEAEKGAKKEAEKEAEKGAKINGNESN
YYSNIKNAQVIGKFSEQLFQIMSSEIKKKNFILNIGGDHGVAFSSILATLQTYKNLKVIW
IDAHGDINIPETSPSGNYHGMSLAHVLGLFKKKVPHFEWSENLLHLKPENVAIIGIRDID
KYEKIILKNCNINYYTMFDIDKKGIYNIICEALNKIDPDQNSPIHISLDIDSVDSIYAPG
TGTIAKGGLNYREINLLMKSISDTKRVVSMDIVEYNPLLDENDKAVHGDSLPIDPNATKT
GKLCLELIARVLGNDIV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatgtatccaaaactacttaacaaaacatatagatgaacaaaatatttatgtt
aaaaaatgtgtttcaattattgggtctccattagctgctggccaatctcttggaggtgta
aataaagcatgtgacaatttgaggcaactcggattatatgatgttattaaagctatgggt
tggaaatataacgatattggaaatattggggaaagtatatcgatcaatacttttctaaat
tcagcaaatgccgaaaagggaatcaaaaaggaggctgaaaaggaggctgaaaagggagcc
aaaaaggaggctgaaaaggaggctgaaaagggagccaaaataaatggcaatgaatcaaac
tactatagcaatataaaaaacgcacaagtgattggcaaatttagtgaacaattatttcaa
atcatgagttcagaaataaaaaaaaaaaattttattttaaatattgggggagatcatgga
gtagctttttcaagcatactagccacactacaaacatataaaaatttaaaagtgatatgg
atagatgcacatggagatataaatataccagaaacatctccttctggaaattatcatgga
atgtcattagcacatgtattaggattgtttaaaaaaaaagttccacattttgaatggtca
gaaaatttgttacatttaaaaccagaaaatgtagctattattggaataagagatattgat
aaatatgaaaaaatcattttaaaaaattgtaatataaattattatactatgtttgatata
gataaaaaaggtatatacaacattatttgtgaagctttaaataaaattgatccagatcaa
aattctcctatacatatatcattagatattgatagtgtcgattcaatatatgctcctgga
actggaacaatagctaaaggtggtttaaattatagagaaataaatttattaatgaaatcg
atatcagatacaaaacgagttgtatctatggatattgttgaatataacccacttttggat
gaaaatgataaagcagttcatggagattcgctaccaattgatcccaatgctactaaaact
ggaaaattatgtcttgagcttattgccagagtcctaggcaatgatatcgtgtaa

DBGET integrated database retrieval system