KEGG   Plasmodium yoelii: PY17X_0712100Help
Entry
PY17X_0712100     CDS       T01035                                 

Gene name
PY06158
Definition
(RefSeq) heat shock protein, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pyo  Plasmodium yoelii
Pathway
pyo03040  Spliceosome
pyo04141  Protein processing in endoplasmic reticulum
pyo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PY17X_0712100 (PY06158)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PY17X_0712100 (PY06158)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PY17X_0712100 (PY06158)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pyo01009]
    PY17X_0712100 (PY06158)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pyo03041]
    PY17X_0712100 (PY06158)
   03009 Ribosome biogenesis [BR:pyo03009]
    PY17X_0712100 (PY06158)
   03110 Chaperones and folding catalysts [BR:pyo03110]
    PY17X_0712100 (PY06158)
   04131 Membrane trafficking [BR:pyo04131]
    PY17X_0712100 (PY06158)
   03051 Proteasome [BR:pyo03051]
    PY17X_0712100 (PY06158)
   03029 Mitochondrial biogenesis [BR:pyo03029]
    PY17X_0712100 (PY06158)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pyo04147]
    PY17X_0712100 (PY06158)
Protein phosphatases and associated proteins [BR:pyo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PY17X_0712100 (PY06158)
Spliceosome [BR:pyo03041]
 Complex B
  Other components
   Prp19 complex
    PY17X_0712100 (PY06158)
 Complex C
   Prp19-CDC5 complex
    PY17X_0712100 (PY06158)
Ribosome biogenesis [BR:pyo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PY17X_0712100 (PY06158)
Chaperones and folding catalysts [BR:pyo03110]
 Heat shock proteins
  HSP70 / DNAK
   PY17X_0712100 (PY06158)
Membrane trafficking [BR:pyo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PY17X_0712100 (PY06158)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PY17X_0712100 (PY06158)
Proteasome [BR:pyo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PY17X_0712100 (PY06158)
Mitochondrial biogenesis [BR:pyo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PY17X_0712100 (PY06158)
Exosome [BR:pyo04147]
 Exosomal proteins
  Proteins found in most exosomes
   PY17X_0712100 (PY06158)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR DUF5581
Motif
Other DBs
NCBI-GeneID: 3792094
NCBI-ProteinID: XP_726754
UniProt: A0A078K5J1
Position
7
AA seq 682 aa AA seqDB search
MANAKASKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTER
LIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGIEEKPMIEVVYQ
GEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLN
VMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHL
GGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSL
FEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQ
TLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAVQDLLLLDVCSLSLGLETAG
GVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPA
PRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSPEEIDRMVNDAEKYKA
EDEENKKRIEARNSLENYCYGVKSSLEDQKIKEKLQPNEVETCMKSVTSILEWLEKNQLA
GKDEYEAKQKEAEAVCSPIMSKIYQDAGAAAGGMPGGMPGGMPGGMPGGMPGGMNFPGGM
PGGMGAPAGAPAGSGPTVEEVD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgcaaaagcatcaaagccaaatttaccagagtcaaatatagctataggtatt
gatttgggtaccacatattcttgtgttggtgtgtggagaaatgaaaatgtcgatataatt
gcaaacgatcaaggtaatagaacaaccccatcttatgtagcttttacagatacagaaaga
ttaattggtgatgcagctaaaaatcaagttgcacgaaatccagagaatacagtttttgat
gctaagagattaattggaagaaaattcacagaatcttctgtacaaagtgatatgaaacac
tggccatttactgtaaagtcaggtattgaagaaaaaccaatgattgaagttgtttatcaa
ggagaaaagaaattattccatcctgaagaaatatcttctatggttttacaaaaaatgaaa
gaaaatgcagaagcctttttaggaaaatctataaaaaatgctgttattacagtacctgct
tattttaatgattctcaaagacaagcaacaaaagatgctggtactattgcaggattaaat
gtaatgagaattattaatgaaccaactgcagcagctattgcatatggtttacataaaaaa
ggaaaaggtgaaaaaaatatattaattttcgatttaggaggtggtacatttgatgtttca
ttacttactattgaagatgggatatttgaagttaaggcaactgcaggagatacacattta
ggtggtgaagattttgataatcgtttagttaatttttgtgttgaggattttaaaagaaaa
aatagaggaaaagatttatcaaaaaatagtagagcattaagaagattaagaacccaatgt
gaaagagcaaaacgtacattatcatcttctacacaagctacaattgaaatagattctctt
tttgaaggtattgattatagtgttactgtaagtagagctagatttgaagaattatgtata
gattattttagagatactttaatacctgttgaaaaagttttaaaagatgctatgatggat
aaaaaaagtgttcatgaagttgtattagttggtggatcaactagaattccaaaaattcaa
acattaataaaagaattttttaatggaaaagaagcatgtagatcaataaaccctgatgaa
gctgttgcatatggtgctgctgttcaagctgctatattatcaggagatcaatcaaatgct
gtacaagatttattattattagatgtatgttcattatctttaggattagaaactgcagga
ggtgttatgacaaaattaattgaaagaaatacaacaattccagctaaaaaaagtcaaata
tttacaacatatgctgataaccaaccaggagtcttaatacaagtatatgaaggagaaaga
gctttaacaaaagataataatttattaggtaaatttcatttagatggtatcccacctgct
cctagaaaagtaccacaaattgaagttacattcgatattgatgctaatggtattttaaat
gttacagctgttgaaaaaagtactggtaaacaaaaccatattacaattacaaatgataaa
ggtagattatctcctgaagaaattgatagaatggttaatgatgctgaaaaatataaagca
gaagatgaagaaaataaaaaaagaattgaagccagaaatagtcttgaaaattattgctat
ggtgttaaaagttcattagaagatcaaaaaattaaagaaaaattacaacctaatgaagtt
gaaacatgtatgaaatctgttacttctattcttgaatggttagaaaaaaatcaattagct
ggaaaggatgaatatgaagctaaacaaaaagaagctgaagctgtatgctctccaattatg
tctaaaatatatcaagatgctggtgcagctgctggtggtatgccaggtggaatgccaggt
ggaatgccaggaggaatgccaggaggaatgccaggaggaatgaacttcccaggtggaatg
ccaggaggaatgggagcacccgctggagccccagctggaagtggaccaactgttgaagaa
gttgattaa

DBGET integrated database retrieval system