KEGG   Plasmodium yoelii: PY17X_0928200Help
Entry
PY17X_0928200     CDS       T01035                                 

Gene name
PY06965
Definition
(RefSeq) conserved Plasmodium protein, unknown function
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pyo  Plasmodium yoelii
Pathway
pyo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    PY17X_0928200 (PY06965)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 3854175
NCBI-ProteinID: XP_022812220
Position
9
AA seq 512 aa AA seqDB search
MKGVKYFFLIIICVIYLAKSYTIDESANVLPLDNNLVHVKLKLDVNGKDYKDNFLPINVL
KVLNYVKSLKINIKRGVYRNYYNNRYLDKYPYGFTLEVELKKGDNDNNNKETENSEFSKH
EIFILHQLLNEIWSITGVSSNLLKIRDMIKVHNKIFAFLPDESICTEYFSFIKKLYPCKD
FGGLFNAINSTYLISKLSTNIGFELNDNDENLLLLYIDYITHHDQKKDVRIIDLIDSKYS
LNDCPLINRNTLVVQKKDEGFISTIFKNHGTINLFYENINLYNILQISQQNILEEYINVD
VIREEANSMITSDIKKKQSSLLYIFQNFNPNQNSDFLFVDKLPYHLTPLLHTIMIQGNAP
NDYDKSKGKCNFIYFGETALKKFNIKFSNFDNIENIPKSGSFYYIHFEHNLPPLCKITIR
FEVVKIRIRSFEFEFDIDRGILLGSGIFMQKRNHSLPENNDFMYKYTPSILIDIVLPDTS
MPFNVMAIATCVIMLFFGFIFKLTAKEETRYI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgtaaaatatttttttttaataataatatgtgtgatatatttagcaaaatca
tataccatagatgaaagtgccaatgtattacctctcgataataatttagtacatgttaaa
ctaaaattggatgttaatggaaaagattataaagataactttcttccaataaatgtatta
aaagtattgaattatgtcaagtctcttaaaataaatataaaaaggggggtttacagaaat
tattacaacaacagatatttggacaaatatccatatggttttactcttgaagttgaacta
aaaaagggagacaatgataataacaataaagaaacggaaaatagcgaattttcaaagcat
gaaatatttattttacatcaattattaaacgaaatatggtctattactggtgtatcgagt
aatcttttgaaaataagggatatgataaaagttcataataaaatttttgcattcctacct
gatgaaagtatatgtactgaatatttttcatttattaagaagttatatccatgtaaagat
tttggaggattattcaatgcaataaattcaacatatttaatatctaagctttctaccaat
ataggatttgaattaaatgataatgatgaaaatttgttattattatacatcgattatatt
acacaccatgatcaaaaaaaagatgttagaattatagatttaatagattcgaaatatagt
ttaaatgattgtccgttgataaatagaaatacacttgttgttcaaaaaaaggatgaaggt
tttatttcaacaattttcaaaaaccatggtacaataaatttgttttatgaaaatataaat
ttatataatattttgcaaatttcacaacaaaatatattagaagaatatataaatgttgat
gtaattagagaagaagctaatagtatgataacttctgatataaaaaaaaaacaaagttca
ttattatatatatttcaaaattttaatccaaatcaaaatagtgattttctattcgttgat
aaattaccttatcatttaacacctttattacacacaataatgattcaagggaatgcccct
aatgattatgataagtcaaagggaaaatgtaattttatttattttggtgaaaccgcactt
aaaaaatttaacattaaatttagcaactttgataatattgaaaatatacccaaaagtgga
agcttttattacattcattttgaacacaatttaccaccattgtgtaaaataacaataaga
tttgaagtagttaaaatccgtattagatcattcgaatttgagtttgacatagatagaggt
attctattaggtagtggaatatttatgcaaaaacgaaaccatagtttacctgaaaataat
gatttcatgtataaatatactccatcaattcttatagatatagttttaccagatacaagt
atgccctttaacgttatggcaatcgcaacatgtgttattatgttattttttggattcata
tttaagcttactgcaaaagaagaaacaagatatatttga

DBGET integrated database retrieval system