KEGG   Plasmodium yoelii: PY17X_0941000Help
Entry
PY17X_0941000     CDS       T01035                                 

Gene name
PY05049
Definition
(RefSeq) succinyl-CoA synthetase alpha subunit, putative
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00020  Citrate cycle (TCA cycle)
pyo00640  Propanoate metabolism
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
pyo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PY17X_0941000 (PY05049)
   00640 Propanoate metabolism
    PY17X_0941000 (PY05049)
Enzymes [BR:pyo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PY17X_0941000 (PY05049)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PY17X_0941000 (PY05049)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 3790787
NCBI-ProteinID: XP_022812270
Position
9
AA seq 329 aa AA seqDB search
MKYSNIKNLCFPLKGRNYSATSKVFIDKNTTVICQGLTGKQGSFHTTEALKYGTKMVGGV
NPSKKGSTWASIDNKYTLPVFGSVLEAKEKTNCYASVIYVPHQHAKNAIIESIESEIPLI
VCITEGICQHDMLEVKACLNMSKKSRLIGPNCPGIIKPGESKIGILPSHIHKKGCVGIVS
RSGTLTYEGVNQTTKVGLGQSTCIGIGGDPFHGTNFIDCLKLFLEDDETKCILLIGEIGG
NAEEQVAEWLIENNVDDPEKKKKKKNIFAFIAGKCAPPGKRMGHAGALISGGKGTADGKI
EALRNAGVHVVINPTKIGEEIYNVMKDII
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattctaatatcaaaaatttgtgtttccctttaaagggacgaaattattctgct
accagcaaagtgtttattgataaaaacacaacagtaatatgtcaaggccttacagggaaa
caaggtagttttcacacaacagaggcactaaaatatggaacgaaaatggttggtggtgtg
aacccatcaaaaaaaggaagtacatgggcaagtattgataataaatacacattacctgtt
tttgggtctgttcttgaagctaaagaaaaaacaaactgctatgcatcagttatttatgta
ccacatcaacatgctaaaaatgcaattatcgaatctattgaatctgaaataccattaatt
gtttgtataacagaaggtatatgccaacatgatatgttagaagtaaaggcatgtttaaat
atgtcaaaaaaaagccgattaataggtcctaattgtccaggaattataaaaccaggcgaa
tcgaaaattggaattttaccatcacatattcataaaaaaggttgtgtaggaattgtaagt
agaagtggtacattaacatatgaaggagtaaatcaaacaacaaaagttggtttaggtcaa
tctacttgcataggtatagggggagacccatttcatggtacaaattttattgactgtctt
aaattatttttagaagatgatgaaacaaaatgcatattattaattggagaaattggaggt
aatgcagaagaacaagtagctgaatggttaatagaaaataatgttgatgatccagaaaaa
aaaaaaaaaaaaaaaaacatatttgcatttatagctggtaaatgtgcacctccaggaaag
cgtatgggtcatgctggcgcattgattagtggaggtaaaggaacagctgatggaaaaatt
gaagctttaagaaatgcaggtgttcatgttgttattaatcctactaaaataggcgaagaa
atatataatgtcatgaaggatataatataa

DBGET integrated database retrieval system