KEGG   Plasmodium yoelii: PY17X_1318400Help
Entry
PY17X_1318400     CDS       T01035                                 

Gene name
PY01991
Definition
(RefSeq) acetyl-CoA acetyltransferase, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00071  Fatty acid degradation
pyo00280  Valine, leucine and isoleucine degradation
pyo00310  Lysine degradation
pyo00380  Tryptophan metabolism
pyo00620  Pyruvate metabolism
pyo00630  Glyoxylate and dicarboxylate metabolism
pyo00640  Propanoate metabolism
pyo00900  Terpenoid backbone biosynthesis
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
pyo01200  Carbon metabolism
pyo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PY17X_1318400 (PY01991)
   00630 Glyoxylate and dicarboxylate metabolism
    PY17X_1318400 (PY01991)
   00640 Propanoate metabolism
    PY17X_1318400 (PY01991)
   00650 Butanoate metabolism
    PY17X_1318400 (PY01991)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PY17X_1318400 (PY01991)
   00072 Synthesis and degradation of ketone bodies
    PY17X_1318400 (PY01991)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PY17X_1318400 (PY01991)
   00310 Lysine degradation
    PY17X_1318400 (PY01991)
   00380 Tryptophan metabolism
    PY17X_1318400 (PY01991)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PY17X_1318400 (PY01991)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pyo04147]
    PY17X_1318400 (PY01991)
Enzymes [BR:pyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PY17X_1318400 (PY01991)
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PY17X_1318400 (PY01991)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-GeneID: 3807129
NCBI-ProteinID: XP_729832
UniProt: A0A077YCC7
Position
13
AA seq 397 aa AA seqDB search
MIANNVKKVFVAGYARTPIGSLCGTLSQIPVHKLAIPTILKSLERSQIEKDIVDCVIFGQ
SFSSGCGPLPLQKILVSTGINMNAKTHLINNLCCSGLDSVTLGYDLIKSGKDVCVVGSME
SMSQSSFFLKKLRTETCKLGNVTFNDSVIHDGYEYISNNKELKKNNNMELFCKKHKIPRI
DLDNYVINSYKRAANAYSENLIPQEIFPLIIQKKKNTLEYEKIVIDTDEIYKKCNIDNIC
NLSNESIITNYNIAPFADGACSIVLMSEDKINELGLNPLVEIVAYDNASVQPCDSPLSIS
YSILKCLKKINKSFVDYYEINESSALDVIFNVKNLGIDMSNVNINGGALSLGHPTAVSGS
RILISLITILKNFDMKFGCASINNYLGSATSVVVENV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatagcaaataatgttaaaaaagtttttgttgcgggttatgctcgaacccctataggt
tctttatgtggaacactttctcaaatacccgttcataaattagctatacccacaatatta
aaatcactagaaagaagtcaaatagaaaaagacatagttgattgtgtaatttttgggcaa
tcattttctagtggatgtggacctttacctcttcaaaaaattcttgtttctacaggtatt
aacatgaatgccaaaacacatcttattaataatttgtgttgtagtggattagattcagtg
accttaggatatgatttaataaaatcaggaaaagatgtctgtgttgttggatcaatggaa
tcaatgtctcaaagttcattttttttgaaaaaattaagaacagaaacatgcaaattaggg
aatgttacttttaatgatagtgtaatacatgatggatatgaatatatatcaaataataaa
gaattaaaaaaaaataataatatggaattattttgtaaaaaacataaaattccaagaatt
gacttagataattatgttataaattcatataaaagagcagcaaatgcatatagtgaaaat
ttaataccacaagaaatatttcctttaataattcaaaaaaaaaaaaatacattagaatac
gaaaaaatagttattgacactgatgaaatatataaaaaatgtaatattgataatatttgt
aatttaagtaacgaaagtattattacaaattataatatagctccatttgctgatggtgca
tgttcaatagttttaatgagtgaagacaaaattaatgagcttggtttaaatccattagta
gaaattgtagcttatgacaatgcttctgtacaaccatgtgattctcctttaagtatttcc
tattctatattaaaatgcttaaaaaaaattaataaatcttttgttgattattatgaaatt
aatgaatcttcagcattagatgttatttttaatgttaaaaatttgggtatagatatgtct
aatgtaaatattaatggaggagctttatcattgggacatccaactgctgtatcaggttca
agaattcttatatcattaataactatattaaagaattttgatatgaaatttggttgcgca
tctataaataattatttaggttctgcgacatcagttgtcgtggaaaatgtgtaa

DBGET integrated database retrieval system