KEGG   Plasmodium yoelii: PY17X_1430800Help
Entry
PY17X_1430800     CDS       T01035                                 

Gene name
PY04546
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit 10, putative
  KO
K03254  translation initiation factor 3 subunit A
Organism
pyo  Plasmodium yoelii
Pathway
pyo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PY17X_1430800 (PY04546)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pyo03012]
    PY17X_1430800 (PY04546)
Translation factors [BR:pyo03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    PY17X_1430800 (PY04546)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI RIH_assoc
Motif
Other DBs
NCBI-GeneID: 3790188
NCBI-ProteinID: XP_724858
UniProt: A0A077YBK7
Position
14
AA seq 1268 aa AA seqDB search
MQTFQKPENALKRAEELQFIGQNEDALQILHAAIGHRTFRLQGWHVLQEQIMLRYIEFCL
YLEKLSLVKDGLHQYRIICQHGNIASLGKVITDFRDKAEEKVRLAKENMNINKDKIEQEE
SNVDFTEKILMNSLDMEITGKYERKLQNAYKICMETYKMILEILRATPKLEKAYHDTAKK
ALLFCKENKRLTEFKKLSDLLRNHYNLILRGKHKPEYQSLLKIEYHLETKIMQLETACEL
GMWKEASNIAEDIYNLNMHEYFYKTLKSGAMESDMNNNADQNDSKKKSSDKDEEKDTNEA
TTSGGVASTSAIASQNKQKENLKKWIATFYEKLADILFVYESELFHGLAWLKYCFHILNY
GIEISEERKKFICTKAVLAVLSIPRIGNKKNEDYAKIFEAHKKMSQLLGHTSVPVKESLK
NGLKVRNILNYADENAQKLYSLVENKFTPLSLCLECEVLLKELEKTEHNIYINKIKEVIF
HKLILQLSKVYNYISIDYFIENICSEHFISWNDAETMLVDLVYQKELEMRIDLTKRAIYF
GDKENVNRSKLIKDSLINMYNELYNGLRMINESISIENEVENTNTKLLNYEHEFNLLDKG
NKHISNYATADIEDIVENEIIDDKPIDDEKILKKIYDKIDEEHHKLQLLSEEHNKKRKEM
LRKQKEQEQAQLKIRMEKRLLEEKLEKEKREELAKKGEKLRIKEEKIKKKSEAAEQMLKE
IKKLCTNSTSKILMKGKYLDEITIEDILNGYVDFEDIEEVQGKIRLNERNEIIKIRKAEA
KKVDHYFRALRQVELSHMNKWIALIFQEDTEILLQEQKAVEEEKKADFEAALKEKEEYMK
FSNDIEEFTKSEMQQRIVEFEKDLKEQKERLHKLLKEEKIQRARDRREQHIRKLKAEEER
KRREEEEERLRKEEIERKKKEEAHKKKLDEISRIQRERDLEIEQQLLKQNEESRSGEKSL
RKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRDRERDRER
DRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRER
DRDRERDRERDRDRERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRER
DYRKDGERENRRGDTRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGIESDENK
KNNIEGDDNGNNLKGNKRDGEKNKDNENANNDKREEKGDEKGQGSDGGGAFTVFTKKKKN
FLRYFTKS
NT seq 3807 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatttcaaaagccggaaaatgctcttaagagagcagaggaattgcagtttatt
ggacaaaatgaagacgctcttcaaattttacatgccgctattgggcatagaacattcagg
ttacaaggatggcatgttttgcaagaacaaattatgttacgatatatcgaattttgttta
tatttagaaaaattaagtttagtaaaagatggcttgcatcaatatagaattatatgccaa
catggtaatatagcatctcttgggaaagtcattactgattttcgagataaagcagaagag
aaggttcgattagctaaagagaatatgaatattaataaagataagatagaacaagaagaa
agtaatgtagattttacagaaaaaattttaatgaattctttagatatggaaataactgga
aaatatgaaagaaaattacaaaatgcttataaaatatgtatggaaacatataagatgatt
ttagaaatattaagagctacccctaaattagaaaaggcatatcatgacactgctaaaaaa
gctttattattttgcaaagaaaataaaagattaacagaattcaaaaaattaagtgatctt
ttaagaaatcattataacttaatcttaagaggaaaacataaacctgaatatcaatctctt
ttaaaaattgaataccatttagaaacaaaaataatgcaacttgaaactgcttgtgaactt
ggcatgtggaaagaggcatcaaatatagcagaagatatttataatcttaatatgcatgaa
tatttttataaaacattaaaatctggagctatggaatcagatatgaataacaatgctgat
caaaatgattccaaaaaaaaaagttctgataaagatgaagaaaaagatacaaacgaagca
actaccagtggcggtgttgcatcgacttcagcaattgctagccaaaacaaacagaaggaa
aatttaaaaaaatggattgcaactttttacgaaaaattggctgatatattatttgtttat
gaaagtgaattatttcatggtttggcatggctaaaatattgtttccatatattaaattat
ggaatagaaatttctgaagaaaggaaaaaatttatatgcacaaaagcagtgcttgctgtt
ctgtcaatacctcgtattggaaacaaaaagaatgaagattatgcaaagatttttgaagca
cataaaaaaatgtcccaattgttaggacatacaagtgttccagtaaaggaatcattgaaa
aatggattaaaagtaagaaatatattaaactatgcagatgaaaatgcacaaaaattatat
tctttagtagaaaataaatttacacctttaagcctgtgtttagaatgtgaagtattatta
aaagagttagaaaaaactgaacataatatatatattaataaaataaaagaagtaatattt
cataaattaatattacaattatcaaaagtatataattatatatctattgattattttatt
gaaaatatatgctctgaacattttatatcatggaatgatgctgaaacaatgttagtagat
ttagtatatcaaaaagagttagaaatgagaatagacttaacaaaaagagctatatatttt
ggtgataaagaaaatgtaaatcgtagtaaattaataaaagattcacttataaatatgtac
aatgaattatataatggattacgaatgattaatgaatctataagtatagaaaatgaagtt
gaaaatacaaatacaaaactattaaattatgaacatgaatttaatttattagataaagga
aataagcatataagcaattatgctactgcagatattgaggatattgtagaaaatgagatt
attgacgacaaaccaatagatgatgaaaaaatattaaaaaaaatatatgataaaatagat
gaagaacatcacaagttacagcttctaagcgaagaacataataaaaaacgaaaggaaatg
ttaagaaaacaaaaagaacaagaacaagctcaattaaaaataagaatggaaaagagatta
ttagaagaaaaattagaaaaggaaaaaagagaagaattagcgaaaaaaggagaaaaactt
agaataaaagaagaaaagataaagaaaaaatcggaagctgcagaacaaatgcttaaagaa
attaaaaaattatgtactaatagtactagtaaaatattaatgaaaggaaaatatcttgat
gaaattactattgaagatatattaaatggatatgtcgattttgaggatattgaagaagta
caaggaaaaatccgattaaatgagagaaatgaaattataaaaattagaaaagctgaagcc
aaaaaagttgatcattattttagagccttaaggcaagttgaacttagtcatatgaataaa
tggatagctttaattttccaagaagatactgaaattttattacaagaacaaaaagcagtt
gaagaagagaaaaaagccgattttgaagctgcacttaaagagaaggaagaatacatgaaa
ttttctaatgacattgaagaatttactaaatcagaaatgcagcaaagaatagtagaattt
gaaaaagatctaaaagaacaaaaagagcgtttacataaattattaaaagaagaaaaaata
caaagagctagagatagaagggagcaacatatcaggaaattaaaagcggaagaagaaaga
aaaagaagagaagaagaagaagagaggttaagaaaggaagaaatcgaaaggaaaaaaaaa
gaagaagctcataaaaaaaaactagacgaaatcagtagaatacaaagagaaagagactta
gaaatagaacaacaattattaaaacaaaatgaagaatccagaagtggagaaaaatctttg
aggaaatcatccgccgatgatgaattcacatggagaagacatgaaacaggtacttctcaa
tatgacgatgataattataaaaggcatcatgaaaataatgatgaccattacagagatgct
tctgagaaaaaggatagaaaaacttggtccggaagagatagagaaagagatagagaaaga
gacagggacagagatagagaacgagatagagacagagacagagaacgagatagagacaga
gatagagatagaaaatacagaagggaaaaagaatacagaagagatagatcaaaggataga
gaaagagacagagatagagaaagagatagagaaagagatagagaaagagacagagaaaga
gacagagatagagaaagagatagggaaagagatagagacagagaaagagatagagacaga
gaaagagaaagagatagagacagagaaagagatagagaaagagatagagatagagaacga
ggtagagattacagaaaggataaggatcacagaagagatagagaaagggatagagaacga
gattatagaaaagatggcgaaagagaaaatagaagaggagatactagaagaagtgaaaat
gatcgagaaaaaaaaagagataaagatgattatactccaaataatagtgataatgaaaaa
gaaagaaatgcttggaatatacgaaatgatgacggtggcattgaatcagatgaaaataaa
aaaaataatatagaaggtgatgataatggaaacaatttgaaaggaaataaaagagatgga
gaaaaaaataaggataatgaaaatgccaacaatgataaacgagaagaaaaaggtgatgaa
aagggacaaggatccgatggaggaggagcttttacagtttttaccaaaaaaaaaaaaaac
tttttaagatattttacgaaatcttag

DBGET integrated database retrieval system